Align ABC transporter for Xylitol, permease component 2 (characterized)
to candidate GFF1646 PGA1_c16690 binding protein-dependent transport system, inner membrane component
Query= reanno::Dino:3607127 (272 letters) >FitnessBrowser__Phaeo:GFF1646 Length = 283 Score = 162 bits (411), Expect = 6e-45 Identities = 82/267 (30%), Positives = 150/267 (56%), Gaps = 2/267 (0%) Query: 8 FSQIALLVLIITVCVFPFYWMVTTSLKTQ-IVALEAPPVWIFEPTLSNYREALFEDGVLR 66 F + A + + +FP YW++ ++ ++ E + T N+ LFE L Sbjct: 16 FGKYAAIAFYLGFALFPLYWLMKIAITPDALIFSEGTRMLPSAVTFENFATVLFETEFLA 75 Query: 67 TLINSLIIAISTTFLALVLGVPAAFALARFEFRGKKDLWFWFITNRMISPIVLALPFFLI 126 NSL +++ T F ++ A +A +RF F GK+ + + +M +++ P + I Sbjct: 76 YFRNSLTVSLGTAFFTTLIAAGAGYAFSRFVFAGKRIIIAVMLITQMFPLLMIIAPIYKI 135 Query: 127 ARNLGLLDKHITLILIYLTFNLPIVIWIVTDQFRGIPYDLDEAARLEGASQFTIMRKICL 186 +LGLL+ +LI++Y FN+P +++ F GIP DL+EAA ++G S+F +R + Sbjct: 136 VADLGLLNSLTSLIVVYTAFNIPFATFLMQSFFDGIPKDLEEAAMMDGCSRFQALRTVVF 195 Query: 187 PLAMPGVAVSAIFSFIFSWNELMFGLIL-TRSEAKTAPAMAVSFMEGYNLPYGKIMATST 245 PL +PG+ + F F +W+EL+F L+L ++++A T P ++F+ +++ +G++MA Sbjct: 196 PLTLPGLGATLGFVFTAAWSELLFALMLISKNDAMTFPVGLLTFVSKFSVDWGQMMAAGV 255 Query: 246 LIVIPVLIFALIASKQLVRGLTMGAVK 272 L ++P +F + + LV+GLT GAVK Sbjct: 256 LALVPSCLFFIFIQRYLVQGLTSGAVK 282 Lambda K H 0.331 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 222 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 283 Length adjustment: 25 Effective length of query: 247 Effective length of database: 258 Effective search space: 63726 Effective search space used: 63726 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory