Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate GFF1647 PGA1_c16700 binding protein-dependent transport system, inner membrane component
Query= uniprot:D8IPH8 (292 letters) >FitnessBrowser__Phaeo:GFF1647 Length = 316 Score = 130 bits (327), Expect = 4e-35 Identities = 84/281 (29%), Positives = 143/281 (50%), Gaps = 7/281 (2%) Query: 10 PYLFLGPSLLVMLVLGLVPTVAAINLALKNRVLRYP-DSDYVWLRNLERLMSDRRFLNAI 68 P+L+L P +L++ + L+P + I+ + ++ L P + +V N E+L SDR+F A+ Sbjct: 33 PFLYLSPMILLIGSVMLIPLIVGISYSFQSIELLNPFATGWVGFENYEKLWSDRKFWIAL 92 Query: 69 EVSAVWEVVTVLGAVIVGIAIAVYLFENVHGKWRQAMCVLLITPVLLPRVSAAFIWKFMY 128 E + W ++ +G+ +A+ L GK + L+ P +P +A W +++ Sbjct: 93 ENTFFWTFWSIFFQFFLGLGLAMLLNTQFFGK--KLFQALVFLPWAVPTFLSALTWAWLF 150 Query: 129 SPLTGILGWLLGLVGIHDTAF--LSDPALALYAVALVDIWQWGLFFAVIVLKLLETLPPE 186 +P+ G + L +G+ + L DP LA++ +IW FFA+ +L L+++P E Sbjct: 151 NPVIGPIPHWLAALGVLSEPYNILGDPDLAIWGPITANIWFGVPFFAITLLAALQSIPGE 210 Query: 187 PLEAARLDYARTWQVYAYIALPMLKGPLISLVFIKMVESLRSFDLIYVMTKGGPGVATET 246 EAA +D A WQ + I LP L + V ++ + DLI+VMT GGP +T+ Sbjct: 211 LYEAAEIDGATPWQSFTKITLPFLAPMIAITVMLRTIWIANFADLIFVMTGGGPANSTQI 270 Query: 247 LDMYAYAQGIGLSGKVSYASTMAV-LMMIATTLIFTLIWKR 286 L Y + YAST+AV L++I L+W R Sbjct: 271 LSTYIFTTAF-RKLDFGYASTIAVALLIILLAYAVILLWMR 310 Lambda K H 0.328 0.141 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 309 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 316 Length adjustment: 27 Effective length of query: 265 Effective length of database: 289 Effective search space: 76585 Effective search space used: 76585 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory