Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate GFF1646 PGA1_c16690 binding protein-dependent transport system, inner membrane component
Query= uniprot:D8IPH9 (270 letters) >FitnessBrowser__Phaeo:GFF1646 Length = 283 Score = 103 bits (257), Expect = 4e-27 Identities = 74/245 (30%), Positives = 111/245 (45%), Gaps = 3/245 (1%) Query: 21 AVFPLLWALLNSVKTLLDIVTPTPRFLFTP-TLENYRQVIGSPEVLVGLTNSAVIVGSAV 79 A+FPL W + ++ I + R L + T EN+ V+ E L NS + Sbjct: 29 ALFPLYWLMKIAITPDALIFSEGTRMLPSAVTFENFATVLFETEFLAYFRNSLTVSLGTA 88 Query: 80 LLGTFMGVPAAYVIARYHVPGKRDIQFFLLSLRFLPPVAVAIPLIAIWVDLGLYDTRFSM 139 T + A Y +R+ GKR I +L + P + + P+ I DLGL ++ S+ Sbjct: 89 FFTTLIAAGAGYAFSRFVFAGKRIIIAVMLITQMFPLLMIIAPIYKIVADLGLLNSLTSL 148 Query: 140 IVTYLLTTLSTITWLSIPVFQRMPREIEEAATLDGYGPYAVFWKIALPNCATTLLGGIIF 199 IV Y + T+L F +P+++EEAA +DG + + P L + F Sbjct: 149 IVVYTAFNIPFATFLMQSFFDGIPKDLEEAAMMDGCSRFQALRTVVFPLTLPGLGATLGF 208 Query: 200 SFVLVWNELMIALALTSSNSA-TLPVVASAFTSMGQEVPWGVINASTVLLALPPLIFVGV 258 F W+EL+ AL L S N A T PV F S V WG + A+ VL +P +F Sbjct: 209 VFTAAWSELLFALMLISKNDAMTFPVGLLTFVSK-FSVDWGQMMAAGVLALVPSCLFFIF 267 Query: 259 LSRLL 263 + R L Sbjct: 268 IQRYL 272 Lambda K H 0.327 0.142 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 270 Length of database: 283 Length adjustment: 25 Effective length of query: 245 Effective length of database: 258 Effective search space: 63210 Effective search space used: 63210 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory