Align Lmo2663 protein (characterized, see rationale)
to candidate GFF759 PGA1_c07730 putative zinc-binding alcohol dehydrogenase
Query= uniprot:Q8Y414 (343 letters) >FitnessBrowser__Phaeo:GFF759 Length = 326 Score = 103 bits (257), Expect = 6e-27 Identities = 91/293 (31%), Positives = 130/293 (44%), Gaps = 28/293 (9%) Query: 1 MKAVVKTNPGYDQMELKDVEEPQVYGDKVKIKVAFTGICGSDIHTFKGEYKNPTTPVTLG 60 MKA+V G + + +DV + I++ +GICGSD+H + G P+ LG Sbjct: 1 MKALVYE--GVETLVFRDVPMVAARPGEHLIRIHASGICGSDMHAYLGHDNRRPAPLILG 58 Query: 61 HEFSGVVVEVGPDVTSIKVGDRVTSETTFETCGECIYCKEHDYNLCSNRRGIG-TQANGS 119 HE +G +E GP + G RVT TCG C C NLC++R+ I G+ Sbjct: 59 HEAAG-TIEDGP-----QAGRRVTI-NPLVTCGSCAACAAGRENLCASRQIISMPPREGA 111 Query: 120 FAEFVLSREESCHVLDERISLEAAALTEPLACCVHSA-LEKTTIRPD--DTVLVFGPGPI 176 FA+FV E + + E + L AAL EPLA H+A L + PD LV G G I Sbjct: 112 FAQFVAMPERNLVTVPEDVPLSKAALAEPLAVSWHAARLALKALHPDMERRALVIGGGAI 171 Query: 177 GLLLAQVVKAQGATVIMAGITKDSDRLRLAKELGMDRIVDTLKEDLAEVVLGMTGGYGAE 236 GL A ++A G + + R LA G + + + + +VL GY A Sbjct: 172 GLAAALALRAMGVEDVAVQEPNAARRAFLADHCGQQAVAEF--QGIVPLVLDAV-GYAAT 228 Query: 237 RVFDCSGAVPAVNQGLPLTKKKGDFVQVGLFAEKKNAIDEESIIQREIAYIGS 289 R + A P G VGL E +D + +EI +IG+ Sbjct: 229 RAAASAAAAPG-----------GVIAHVGL-GEDAGGLDIRRMTLQEITFIGT 269 Lambda K H 0.317 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 343 Length of database: 326 Length adjustment: 28 Effective length of query: 315 Effective length of database: 298 Effective search space: 93870 Effective search space used: 93870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory