Align D-xylose 1-dehydrogenase (EC 1.1.1.175) (characterized)
to candidate GFF2697 PGA1_c27390 short-chain dehydrogenase/reductase
Query= reanno::Korea:Ga0059261_1894 (259 letters) >FitnessBrowser__Phaeo:GFF2697 Length = 258 Score = 128 bits (322), Expect = 1e-34 Identities = 87/246 (35%), Positives = 127/246 (51%), Gaps = 4/246 (1%) Query: 16 LKGKRVLVTGGGSGIGAGIVEGFARQGADVTFFDIAGAESQLLVERLSADGHKACFERVD 75 L GKR LVTG SGIG A GA VT + LV + A +A +D Sbjct: 11 LDGKRALVTGASSGIGRACAVALAEAGAHVTIAARRIEPLEALVAEMQAADMQAEVMVLD 70 Query: 76 LTDVASLQAVIARLIKGAGGFDILVNNAANDDRHAIDEITEAYWDERLSVNLKHIFFCAQ 135 + D+A+ +A I+ I G FDILVN+A + TE +D + +N+K +F Q Sbjct: 71 VADIAATRASISERITQNGAFDILVNSAGLARHSPASDTTEGDFDAVIDLNIKGAYFLTQ 130 Query: 136 AVVPAMRARG-GGAIVNLGSISWHLGLSDLVLYQTCKAAIEGLTRSLARDLGRDGIRATC 194 AV + A G G+++N+ S +G D +Y K A+EG T+S+A + G+ GIR Sbjct: 131 AVAKGLMAAGKPGSLINISSQMAKVGGLDRAVYSATKHAVEGFTKSMAIEWGKSGIRVNT 190 Query: 195 VIPGNVRTP-RQLKWYSPEGEAEIVAAQCLDGRLAP-EDVAAMVLFLASDDARLVTGHSY 252 + P + TP Q + PE A I + L GR+ ED+ V++LASD + L+TG + Sbjct: 191 ICPTFIVTPLTQSTFDRPERRAWIESKIQL-GRIGEVEDIMGGVVYLASDASSLITGTAL 249 Query: 253 FVDAGW 258 +D GW Sbjct: 250 MIDGGW 255 Lambda K H 0.321 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 258 Length adjustment: 24 Effective length of query: 235 Effective length of database: 234 Effective search space: 54990 Effective search space used: 54990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory