Protein PP_1017 in Pseudomonas putida KT2440
Annotation: PP_1017 mannose/glucose ABC transporter, permease protein
Length: 281 amino acids
Source: Putida in FitnessBrowser
Candidate for 23 steps in catabolism of small carbon sources
Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
D-cellobiose catabolism | gtsC | hi | GtsC (GLcG), component of Glucose porter, GtsABCD (characterized) | 100% | 100% | 557.4 | ABC transporter for D-Cellobiose and D-Salicin, permease component 1 | 49% | 286.6 |
D-glucose catabolism | gtsC | hi | GtsC (GLcG), component of Glucose porter, GtsABCD (characterized) | 100% | 100% | 557.4 | ABC transporter for D-Cellobiose and D-Salicin, permease component 1 | 49% | 286.6 |
lactose catabolism | gtsC | hi | GtsC (GLcG), component of Glucose porter, GtsABCD (characterized) | 100% | 100% | 557.4 | ABC transporter for D-Cellobiose and D-Salicin, permease component 1 | 49% | 286.6 |
D-maltose catabolism | gtsC | hi | GtsC (GLcG), component of Glucose porter, GtsABCD (characterized) | 100% | 100% | 557.4 | ABC transporter for D-Cellobiose and D-Salicin, permease component 1 | 49% | 286.6 |
sucrose catabolism | gtsC | hi | GtsC (GLcG), component of Glucose porter, GtsABCD (characterized) | 100% | 100% | 557.4 | ABC transporter for D-Cellobiose and D-Salicin, permease component 1 | 49% | 286.6 |
trehalose catabolism | gtsC | hi | GtsC (GLcG), component of Glucose porter, GtsABCD (characterized) | 100% | 100% | 557.4 | ABC transporter for D-Cellobiose and D-Salicin, permease component 1 | 49% | 286.6 |
D-xylose catabolism | gtsC | hi | ABC transporter for D-Glucose-6-Phosphate, permease component 1 (characterized) | 90% | 100% | 513.5 | ABC transporter for D-Galactose and D-Glucose, permease component 2 | 84% | 485.3 |
D-galactose catabolism | PfGW456L13_1896 | hi | ABC transporter for D-Galactose and D-Glucose, permease component 2 (characterized) | 84% | 100% | 485.3 | ABC transporter for D-Cellobiose and D-Salicin, permease component 1 | 49% | 286.6 |
D-cellobiose catabolism | SMc04257 | med | ABC transporter for D-Cellobiose and D-Salicin, permease component 1 (characterized) | 49% | 94% | 286.6 | GtsC (GLcG), component of Glucose porter, GtsABCD | 100% | 557.4 |
D-mannose catabolism | TT_C0326 | med | Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) | 49% | 100% | 267.3 | GtsC (GLcG), component of Glucose porter, GtsABCD | 100% | 557.4 |
L-arabinose catabolism | xacI | lo | Xylose/arabinose import permease protein XacI (characterized, see rationale) | 34% | 94% | 165.2 | GtsC (GLcG), component of Glucose porter, GtsABCD | 100% | 557.4 |
N-acetyl-D-glucosamine catabolism | SMc02871 | lo | ABC transporter for N-Acetyl-D-glucosamine, permease protein 2 (characterized) | 30% | 96% | 136.7 | GtsC (GLcG), component of Glucose porter, GtsABCD | 100% | 557.4 |
D-glucosamine (chitosamine) catabolism | SMc02871 | lo | ABC transporter for N-Acetyl-D-glucosamine, permease protein 2 (characterized) | 30% | 96% | 136.7 | GtsC (GLcG), component of Glucose porter, GtsABCD | 100% | 557.4 |
D-cellobiose catabolism | msdB2 | lo | Binding-protein-dependent transport systems inner membrane component (characterized, see rationale) | 32% | 93% | 131.3 | GtsC (GLcG), component of Glucose porter, GtsABCD | 100% | 557.4 |
D-maltose catabolism | aglG | lo | ABC transporter for D-Maltose and D-Trehalose, permease component 2 (characterized) | 32% | 62% | 115.9 | GtsC (GLcG), component of Glucose porter, GtsABCD | 100% | 557.4 |
sucrose catabolism | aglG | lo | ABC transporter for D-Maltose and D-Trehalose, permease component 2 (characterized) | 32% | 62% | 115.9 | GtsC (GLcG), component of Glucose porter, GtsABCD | 100% | 557.4 |
trehalose catabolism | aglG | lo | ABC transporter for D-Maltose and D-Trehalose, permease component 2 (characterized) | 32% | 62% | 115.9 | GtsC (GLcG), component of Glucose porter, GtsABCD | 100% | 557.4 |
D-cellobiose catabolism | aglG' | lo | Inner membrane ABC transporter permease protein (characterized, see rationale) | 31% | 54% | 114.8 | GtsC (GLcG), component of Glucose porter, GtsABCD | 100% | 557.4 |
D-glucose catabolism | aglG' | lo | Inner membrane ABC transporter permease protein (characterized, see rationale) | 31% | 54% | 114.8 | GtsC (GLcG), component of Glucose porter, GtsABCD | 100% | 557.4 |
lactose catabolism | aglG' | lo | Inner membrane ABC transporter permease protein (characterized, see rationale) | 31% | 54% | 114.8 | GtsC (GLcG), component of Glucose porter, GtsABCD | 100% | 557.4 |
D-maltose catabolism | aglG' | lo | Inner membrane ABC transporter permease protein (characterized, see rationale) | 31% | 54% | 114.8 | GtsC (GLcG), component of Glucose porter, GtsABCD | 100% | 557.4 |
sucrose catabolism | aglG' | lo | Inner membrane ABC transporter permease protein (characterized, see rationale) | 31% | 54% | 114.8 | GtsC (GLcG), component of Glucose porter, GtsABCD | 100% | 557.4 |
trehalose catabolism | aglG' | lo | Inner membrane ABC transporter permease protein (characterized, see rationale) | 31% | 54% | 114.8 | GtsC (GLcG), component of Glucose porter, GtsABCD | 100% | 557.4 |
Sequence Analysis Tools
View PP_1017 at FitnessBrowser
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Search PFam (including for weak hits, up to E = 1)
Predict protein localization: PSORTb (Gram negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the SEED with FIGfam search
Fitness BLAST: loading...
Sequence
MHSPVDKPVLSLSRMAIHAVLLIAVLLYLVPLVVMLLTSFKTPEDITTGNLLSWPAVITG
IGWVKAWGAVSGYFWNSIMITVPAVLISTAIGALNGYVLSMWRFRGSQLFFGLLLFGCFL
PFQTVLLPASFTLGKLGLASTTGGLVLVHVVYGLAFTTLFFRNFYVSIPDALVKAARLDG
AGFFTIFRRIILPMSTPIIMVCLIWQFTQIWNDFLFGVVFSSGDSQPITVALNNLVNTST
GAKEYNVDMAAAMIAGLPTLLVYVVAGKYFVRGLTAGAVKG
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory