Protein PP_1722 in Pseudomonas putida KT2440
Annotation: FitnessBrowser__Putida:PP_1722
Length: 329 amino acids
Source: Putida in FitnessBrowser
Candidate for 11 steps in catabolism of small carbon sources
Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
putrescine catabolism | potA | hi | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) | 46% | 86% | 278.5 | Ferric ABC transporter ATP-binding protein, component of Iron (Fe3+) uptake porter, AfuABC (FbpABC) (Chin et al. 1996). AfuA has been characterized | 45% | 258.1 |
D-mannitol catabolism | mtlK | med | SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) | 46% | 88% | 249.6 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 46% | 278.5 |
lactose catabolism | lacK | med | ABC transporter for Lactose, ATPase component (characterized) | 41% | 97% | 234.2 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 46% | 278.5 |
D-sorbitol (glucitol) catabolism | mtlK | med | ABC transporter for D-Sorbitol, ATPase component (characterized) | 40% | 97% | 227.6 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 46% | 278.5 |
D-maltose catabolism | musK | med | ABC-type maltose transporter (EC 7.5.2.1) (characterized) | 42% | 76% | 221.5 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 46% | 278.5 |
trehalose catabolism | treV | med | TreV, component of Trehalose porter (characterized) | 43% | 87% | 218.8 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 46% | 278.5 |
xylitol catabolism | HSERO_RS17020 | lo | ABC-type sugar transport system, ATPase component protein (characterized, see rationale) | 51% | 58% | 229.6 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 46% | 278.5 |
D-maltose catabolism | malK | lo | Maltose-transporting ATPase (EC 3.6.3.19) (characterized) | 46% | 69% | 228.8 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 46% | 278.5 |
D-cellobiose catabolism | SMc04256 | lo | ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) | 49% | 66% | 227.3 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 46% | 278.5 |
D-galactose catabolism | PfGW456L13_1897 | lo | ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) | 37% | 92% | 219.2 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 46% | 278.5 |
glycerol catabolism | glpT | lo | GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized) | 34% | 96% | 184.1 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 46% | 278.5 |
Sequence Analysis Tools
View PP_1722 at FitnessBrowser
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MSFVSVQKLQKSYAGSPVFERIDCHIERGEFVTLLGPSGCGKSTLLRCIAGLTSVDSGQI
LLDGHDIVPLSPQKRGIGMVFQSYALFPNMTVEQNVAFGLRMQKVKADESQLRVREVLEL
VELGKFAGRYPHQLSGGQCQRVALARSLVTRPRLLLLDEPLSALDARIRKHLREQIRAIQ
RELGLTTIFVTHDQEEALTMSDRIFLMNQGRIVQSGDAETLYTAPVDLFAAGFIGNYNLL
DADSASRLLQRPVASRLAIRPESITLGEHGELDAEVRSHSLLGNVIRYRVRVREVELVVD
VLNRSPADLHADGKRVSVSIDPTALREVA
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory