Align isobutanoate/2-methylbutanoate--CoA ligase (EC 6.2.1.1) (characterized)
to candidate PP_4063 PP_4063 putative Long-chain-fatty-acid-CoA ligase
Query= metacyc::MONOMER-20125 (556 letters) >FitnessBrowser__Putida:PP_4063 Length = 560 Score = 164 bits (415), Expect = 8e-45 Identities = 156/563 (27%), Positives = 243/563 (43%), Gaps = 64/563 (11%) Query: 24 ATVYGDCTSVV----YDAVSYTWSQTHRRCLCLASSIASLGIENGHVVSVLAPNVPQMYE 79 ATV C S + + Y+W Q + A ++ +LG+ G V + +PN Q Sbjct: 26 ATVARCCDSEALVSRHQGLRYSWRQLAEQVEIYARALIALGVNTGDRVGIWSPNCAQWCI 85 Query: 80 LHFAVPMAGAILNAVNLRLDARTISILLHHSESKLIFVDHLSRDLILEAIALFPKQAPVP 139 L A GAIL +N + +L S + + + EA V Sbjct: 86 LQLASAKVGAILVNINPAYRVGELEYVLRQSGCRWL--------VCAEAFKTSDYHTMVQ 137 Query: 140 RLVFMADESESGNSSELGKEFFCSYKDLIDRGDPDFKWVMPKSEW--------------- 184 LV E S EL E + +I +P + Sbjct: 138 ELV---PELASAAPGELASECLPELRGVISLAANPPAGFLPWHAFAERAGQTSVEACTAR 194 Query: 185 -------DPMILNYTSGTTSSPKGVVHCHRGIF---IMTVDSLIDWGVPKQPVYLWTLPM 234 P+ + YTSGTT +PKG H I M +SL G+ + + +P+ Sbjct: 195 QQSLQFDQPVNIQYTSGTTGAPKGATLSHYNILNNGFMVGESL---GLTARDRMVIPVPL 251 Query: 235 FHANGWSYP-WGMAAVGGTNICLRK-FDSEIIYDMIKRHGVTHMCGAPVVLNMLSNAPGS 292 +H G G G T I FD+E+ + T + G P + + + P Sbjct: 252 YHCFGMVMANLGCITHGSTMIYPNDAFDAELTLRAVAEERATILYGVPTMFIAMLDHPSR 311 Query: 293 E--PLKTTVQIMTAGAPPPSAVLFRT-ESLGFA-VSHGYGLTETAGLVVSCAWKKEWNHL 348 L T + AGA P V+ R + + A V YG+TET+ + + + L Sbjct: 312 AHMDLSTLRSGIMAGATCPIEVMRRVIDQMHMAEVQIAYGMTETSPVSLQTGPDDDLE-L 370 Query: 349 PATERARLKSRQGVGTVMQTKIDVVDPVTGAAVKRDGSTLGEVVLRGGSVMLGYLKDPEG 408 T R T Q + +VD G V R +GE+ RG SVMLGY +P+ Sbjct: 371 RVTTVGR--------TQPQLENKLVD-ADGCIVPR--GEIGELCTRGYSVMLGYWDNPQA 419 Query: 409 TAKSMTADGWFYTGDVGVMHPDGYLEIKDRSKDVIISGGENLSSVEVESILYSHPDILEA 468 TA ++ GW ++GD+ VM GY+ I R+KD+II GGEN+ E+E Y+HP + +A Sbjct: 420 TADAIDPAGWMHSGDLAVMDEQGYVRIVGRNKDMIIRGGENIYPRELEEFFYTHPAVADA 479 Query: 469 AVVARPDEFWGETPCAFVSLKKGLTKKPTEKEIVEYCRSKLPRYMVPKTVVFKEELPKTS 528 V+ P +GE A++ L G T +E+ +C++++ + VP+ + F +E P T Sbjct: 480 QVIGIPCSRYGEEIVAWIKLHPG--HSATVEELQGWCKARIAHFKVPRYIRFVDEYPMTV 537 Query: 529 TGKVQKFILRDMA-RGMGSATAG 550 TGKVQKF +R+++ + +A+AG Sbjct: 538 TGKVQKFRMREISVAEIAAASAG 560 Lambda K H 0.319 0.135 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 752 Number of extensions: 44 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 556 Length of database: 560 Length adjustment: 36 Effective length of query: 520 Effective length of database: 524 Effective search space: 272480 Effective search space used: 272480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory