Align cyclohexa-1,5-dienecarbonyl-CoA hydratase (EC 4.2.1.100) (characterized)
to candidate PP_3732 PP_3732 Enoyl-CoA hydratase/isomerase family protein
Query= BRENDA::O87873 (258 letters) >FitnessBrowser__Putida:PP_3732 Length = 248 Score = 62.0 bits (149), Expect = 1e-14 Identities = 67/236 (28%), Positives = 106/236 (44%), Gaps = 15/236 (6%) Query: 13 ERDGSLLRLRLARP-KANIVDAAMIAAMRQALGEHLQAPALRAVLLDAEGPH-FSFGASV 70 E D LL L RP K N ++ AM + L + PA+ A+++ GPH FS G + Sbjct: 8 ELDQGLLTLAFNRPDKLNALNTAMYQLLGDLLLAAGEDPAVDAIIITG-GPHCFSAGNDL 66 Query: 71 DEHMPDQCAQMLKSLHGLVREMLDSPVPILVALRGQCLGGGLEVAAAGNLLFAAPDAKFG 130 + + + + + + L+R ++ P++ A+ G +G G + + + + K Sbjct: 67 RDFLDNPPSDLDSPVFRLMRVVMGLDKPLIAAVSGAAIGIGATLLLHCDQVLVSRSTKLR 126 Query: 131 QPEIRLGVFAPAASCLLPPRV-GQACAEDLLWSGRSIDGAEGHRIGLIDVLAEDPE---- 185 P LGV S LL PRV GQA A LL + +DG + GL + L E+ E Sbjct: 127 MPFAPLGVCPEFGSSLLLPRVLGQARAARLLLTNALLDGEQMLAWGLANELHENGEQCLE 186 Query: 186 -----AAALRWFDEHIARLSASSLRFAVRAARCDSVPRIKQKLDTVEALYLEELMA 236 A L+ + + R+S L+ + RA +V R Q +E L EE A Sbjct: 187 AARTLARQLQGYPQAALRISKRLLKDSQRAELEATVARESQLF--IECLRTEEARA 240 Lambda K H 0.321 0.135 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 248 Length adjustment: 24 Effective length of query: 234 Effective length of database: 224 Effective search space: 52416 Effective search space used: 52416 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory