GapMind for catabolism of small carbon sources

 

Aligments for a candidate for paaJ2 in Pseudomonas putida KT2440

Align subunit of β-ketoadipyl CoA thiolase (EC 2.3.1.174; EC 2.3.1.16) (characterized)
to candidate PP_1377 PP_1377 beta-ketoadipyl-CoA thiolase

Query= metacyc::MONOMER-3207
         (400 letters)



>lcl|FitnessBrowser__Putida:PP_1377 PP_1377 beta-ketoadipyl-CoA
           thiolase
          Length = 400

 Score =  759 bits (1961), Expect = 0.0
 Identities = 389/400 (97%), Positives = 392/400 (98%)

Query: 1   MRDVFICDAIRTPIGRFGGALAGVRADDLAAVPLKALIEPNPAVQWDQVDEVFFGCANQA 60
           M DVFICDAIRTPIGRFGGALA VRADDLAAVPLKALIE NP VQWDQVDEVFFGCANQA
Sbjct: 1   MHDVFICDAIRTPIGRFGGALASVRADDLAAVPLKALIERNPGVQWDQVDEVFFGCANQA 60

Query: 61  GEDNRNVARMALLLAGLPESIPGVTLNRLCASGMDAIGTAFRAIASGEMELAIAGGVESM 120
           GEDNRNVARMALLLAGLPESIPGVTLNRLCASGMDA+GTAFRAIASGEMEL IAGGVESM
Sbjct: 61  GEDNRNVARMALLLAGLPESIPGVTLNRLCASGMDAVGTAFRAIASGEMELVIAGGVESM 120

Query: 121 SRAPFVMGKAESGYSRNMKLEDTTIGWRFINPLMKSQYGVDSMPETADNVADDYQVSRAD 180
           SRAPFVMGKAES YSRNMKLEDTTIGWRFINPLMKSQYGVDSMPETADNVADDYQVSRAD
Sbjct: 121 SRAPFVMGKAESAYSRNMKLEDTTIGWRFINPLMKSQYGVDSMPETADNVADDYQVSRAD 180

Query: 181 QDAFALRSQQKAAAAQAAGFFAEEIVPVRIAHKKGETIVERDEHLRPETTLEALTKLKPV 240
           QDAFALRSQQKAAAAQAAGFFAEEIVPVRIAHKKGE IVERDEHLRPETTLEALTKLKPV
Sbjct: 181 QDAFALRSQQKAAAAQAAGFFAEEIVPVRIAHKKGEIIVERDEHLRPETTLEALTKLKPV 240

Query: 241 NGPDKTVTAGNASGVNDGAAALILASAEAVKKHGLTPRARVLGMASGGVAPRVMGIGPVP 300
           NGPDKTVTAGNASGVNDGAAA+ILASA AVKKHGLTPRARVLGMASGGVAPRVMGIGPVP
Sbjct: 241 NGPDKTVTAGNASGVNDGAAAMILASAAAVKKHGLTPRARVLGMASGGVAPRVMGIGPVP 300

Query: 301 AVRKLTERLGVAVSDFDVIELNEAFASQGLAVLRELGVADDAPQVNPNGGAIALGHPLGM 360
           AVRKLTERLG+AVSDFDVIELNEAFASQGLAVLRELGVADDAPQVNPNGGAIALGHPLGM
Sbjct: 301 AVRKLTERLGIAVSDFDVIELNEAFASQGLAVLRELGVADDAPQVNPNGGAIALGHPLGM 360

Query: 361 SGARLVLTALHQLEKSGGRKGLATMCVGVGQGLALAIERV 400
           SGARLVLTALHQLEKSGGRKGLATMCVGVGQGLALAIERV
Sbjct: 361 SGARLVLTALHQLEKSGGRKGLATMCVGVGQGLALAIERV 400


Lambda     K      H
   0.318    0.134    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 671
Number of extensions: 18
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 400
Length of database: 400
Length adjustment: 31
Effective length of query: 369
Effective length of database: 369
Effective search space:   136161
Effective search space used:   136161
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

Align candidate PP_1377 PP_1377 (beta-ketoadipyl-CoA thiolase)
to HMM TIGR02430 (pcaF: 3-oxoadipyl-CoA thiolase (EC 2.3.1.174))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR02430.hmm
# target sequence database:        /tmp/gapView.31034.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR02430  [M=400]
Accession:   TIGR02430
Description: pcaF: 3-oxoadipyl-CoA thiolase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
   9.2e-225  732.0   8.7     1e-224  731.8   8.7    1.0  1  lcl|FitnessBrowser__Putida:PP_1377  PP_1377 beta-ketoadipyl-CoA thio


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Putida:PP_1377  PP_1377 beta-ketoadipyl-CoA thiolase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  731.8   8.7    1e-224    1e-224       2     400 .]       3     400 .]       2     400 .] 1.00

  Alignments for each domain:
  == domain 1  score: 731.8 bits;  conditional E-value: 1e-224
                           TIGR02430   2 evyivdairtpiGrygGslssvraddlaavplkallarnpsldaaaiddvilGcanqaGednrnvarmaallaGl 76 
                                         +v+i+dairtpiGr+gG+l+svraddlaavplkal++rnp ++++++d+v++GcanqaGednrnvarma+llaGl
  lcl|FitnessBrowser__Putida:PP_1377   3 DVFICDAIRTPIGRFGGALASVRADDLAAVPLKALIERNPGVQWDQVDEVFFGCANQAGEDNRNVARMALLLAGL 77 
                                         79************************************************************************* PP

                           TIGR02430  77 pvsvpgttvnrlcgsgldalglaaraikaGeadlviaGGvesmsrapfvlGkadsafsrsakledttiGwrfvnp 151
                                         p+s+pg+t+nrlc+sg+da+g+a+rai++Ge +lviaGGvesmsrapfv+Gka+sa+sr+ kledttiGwrf+np
  lcl|FitnessBrowser__Putida:PP_1377  78 PESIPGVTLNRLCASGMDAVGTAFRAIASGEMELVIAGGVESMSRAPFVMGKAESAYSRNMKLEDTTIGWRFINP 152
                                         *************************************************************************** PP

                           TIGR02430 152 klkalyGvdsmpetaenvaeefgvsredqdafalrsqqrtaaaqakGffaeeivpveikqkkGeetvvdkdehlr 226
                                          +k++yGvdsmpeta+nva++++vsr+dqdafalrsqq++aaaqa+Gffaeeivpv+i++kkG e +v++dehlr
  lcl|FitnessBrowser__Putida:PP_1377 153 LMKSQYGVDSMPETADNVADDYQVSRADQDAFALRSQQKAAAAQAAGFFAEEIVPVRIAHKKG-EIIVERDEHLR 226
                                         ***************************************************************.899******** PP

                           TIGR02430 227 aettlealaklkavvredgtvtaGnasGvndGaaalllaseeavkrhgltprarilaaasaGveprvmGlgpvpa 301
                                         +ettleal+klk+v+ +d+tvtaGnasGvndGaaa++las+ avk+hgltprar+l++as Gv+prvmG+gpvpa
  lcl|FitnessBrowser__Putida:PP_1377 227 PETTLEALTKLKPVNGPDKTVTAGNASGVNDGAAAMILASAAAVKKHGLTPRARVLGMASGGVAPRVMGIGPVPA 301
                                         *************************************************************************** PP

                           TIGR02430 302 vkkllaraglsledldvielneafaaqalavlrelgladddarvnpnGGaialGhplGasGarlvltalkqleks 376
                                         v+kl +r+g++++d+dvielneafa+q+lavlrelg+add+ +vnpnGGaialGhplG+sGarlvltal+qleks
  lcl|FitnessBrowser__Putida:PP_1377 302 VRKLTERLGIAVSDFDVIELNEAFASQGLAVLRELGVADDAPQVNPNGGAIALGHPLGMSGARLVLTALHQLEKS 376
                                         *************************************************************************** PP

                           TIGR02430 377 ggryalatlciGvGqGialvierv 400
                                         ggr +lat+c+GvGqG+al+ierv
  lcl|FitnessBrowser__Putida:PP_1377 377 GGRKGLATMCVGVGQGLALAIERV 400
                                         ***********************8 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (400 nodes)
Target sequences:                          1  (400 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.02s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 7.46
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory