Align subunit of 3-oxoadipate enol-lactone hydrolase (EC 3.1.1.24) (characterized)
to candidate PP_1380 PP_1380 3-oxoadipate enol-lactonase 2
Query= metacyc::MONOMER-3221 (263 letters) >FitnessBrowser__Putida:PP_1380 Length = 263 Score = 532 bits (1371), Expect = e-156 Identities = 263/263 (100%), Positives = 263/263 (100%) Query: 1 MAHLQLADGVLNYQIDGPDDAPVLVLSNSLGTDLGMWDTQIPLWSQHFRVLRYDTRGHGA 60 MAHLQLADGVLNYQIDGPDDAPVLVLSNSLGTDLGMWDTQIPLWSQHFRVLRYDTRGHGA Sbjct: 1 MAHLQLADGVLNYQIDGPDDAPVLVLSNSLGTDLGMWDTQIPLWSQHFRVLRYDTRGHGA 60 Query: 61 SLVTEGPYSIEQLGRDVLALLDGLDIQKAHFVGLSMGGLIGQWLGIHAGERLHSLTLCNT 120 SLVTEGPYSIEQLGRDVLALLDGLDIQKAHFVGLSMGGLIGQWLGIHAGERLHSLTLCNT Sbjct: 61 SLVTEGPYSIEQLGRDVLALLDGLDIQKAHFVGLSMGGLIGQWLGIHAGERLHSLTLCNT 120 Query: 121 AAKIANDEVWNTRIDTVLKGGQQAMVDLRDASIARWFTPGFAQAQAEQAQRICQMLAQTS 180 AAKIANDEVWNTRIDTVLKGGQQAMVDLRDASIARWFTPGFAQAQAEQAQRICQMLAQTS Sbjct: 121 AAKIANDEVWNTRIDTVLKGGQQAMVDLRDASIARWFTPGFAQAQAEQAQRICQMLAQTS 180 Query: 181 PQGYAGNCAAVRDADYREQLGRIQVPALIVAGTQDVVTTPEHGRFMQAGIQGAEYVDFPA 240 PQGYAGNCAAVRDADYREQLGRIQVPALIVAGTQDVVTTPEHGRFMQAGIQGAEYVDFPA Sbjct: 181 PQGYAGNCAAVRDADYREQLGRIQVPALIVAGTQDVVTTPEHGRFMQAGIQGAEYVDFPA 240 Query: 241 AHLSNVEIGEAFSRRVLDFLLAH 263 AHLSNVEIGEAFSRRVLDFLLAH Sbjct: 241 AHLSNVEIGEAFSRRVLDFLLAH 263 Lambda K H 0.321 0.137 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 409 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 263 Length adjustment: 25 Effective length of query: 238 Effective length of database: 238 Effective search space: 56644 Effective search space used: 56644 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
Align candidate PP_1380 PP_1380 (3-oxoadipate enol-lactonase 2)
to HMM TIGR02427 (pcaD: 3-oxoadipate enol-lactonase (EC 3.1.1.24))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02427.hmm # target sequence database: /tmp/gapView.16799.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02427 [M=251] Accession: TIGR02427 Description: protocat_pcaD: 3-oxoadipate enol-lactonase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-103 330.2 0.1 4.5e-103 330.0 0.1 1.0 1 lcl|FitnessBrowser__Putida:PP_1380 PP_1380 3-oxoadipate enol-lacton Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Putida:PP_1380 PP_1380 3-oxoadipate enol-lactonase 2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 330.0 0.1 4.5e-103 4.5e-103 2 250 .. 11 260 .. 10 261 .. 0.98 Alignments for each domain: == domain 1 score: 330.0 bits; conditional E-value: 4.5e-103 TIGR02427 2 lhyrlegaeadkpvlvlinSLGtdlrlwdkvlealtkdfrvlryDkrGHGlSdvpegpysiedladdvlallDal 76 l+y+++g++ d+pvlvl+nSLGtdl +wd++++ +++frvlryD+rGHG+S v+egpysie+l++dvlallD l lcl|FitnessBrowser__Putida:PP_1380 11 LNYQIDGPD-DAPVLVLSNSLGTDLGMWDTQIPLWSQHFRVLRYDTRGHGASLVTEGPYSIEQLGRDVLALLDGL 84 89*******.***************************************************************** PP TIGR02427 77 giekaavcGlSlGGliaqaLaarrpdrvealvlsntaakigtaesWeaRiaavraeG...laaladavlerwFtp 148 +i+ka+++GlS+GGli+q+L++++++r+++l l+ntaaki + e+W++Ri++v + G + l+da+++rwFtp lcl|FitnessBrowser__Putida:PP_1380 85 DIQKAHFVGLSMGGLIGQWLGIHAGERLHSLTLCNTAAKIANDEVWNTRIDTVLKGGqqaMVDLRDASIARWFTP 159 *******************************************************99666777899********* PP TIGR02427 149 afreaepaelelvrnmlveqppegYaatcaAirdadlrerleeiavPtlviaGdeDgstPpelvreiadlvpgar 223 +f++a++++++ +++ml++++p+gYa++caA+rdad+re+l++i+vP+l++aG++D++t pe+ r +++ + ga+ lcl|FitnessBrowser__Putida:PP_1380 160 GFAQAQAEQAQRICQMLAQTSPQGYAGNCAAVRDADYREQLGRIQVPALIVAGTQDVVTTPEHGRFMQAGIQGAE 234 *************************************************************************** PP TIGR02427 224 faeieeaaHlpnleqpeafaallrdfl 250 ++ ++ aaHl+n+e +eaf++++ dfl lcl|FitnessBrowser__Putida:PP_1380 235 YVDFP-AAHLSNVEIGEAFSRRVLDFL 260 *****.********************8 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (251 nodes) Target sequences: 1 (263 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 6.89 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory