Align L-proline and D-alanine ABC transporter, permease component 1 (characterized)
to candidate PP_1140 PP_1140 branched chain amino acid transporter - permease subunit
Query= reanno::azobra:AZOBR_RS08235 (301 letters) >FitnessBrowser__Putida:PP_1140 Length = 307 Score = 344 bits (882), Expect = 2e-99 Identities = 171/302 (56%), Positives = 231/302 (76%), Gaps = 3/302 (0%) Query: 3 YFLQQLINGLSLGAIYGLIAIGYTMVYGIIGMINFAHGEIYMIGAFVALITFLAIGSLGI 62 +F QQL+NGL++G+ Y LIAIGYTMVYGIIGMINFAHGE+YMIG++VA I + +GI Sbjct: 6 HFFQQLVNGLTIGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYVAFIALAGLAMMGI 65 Query: 63 TWVPLALLVMLVASMLFTAVYGWTVERIAYRPLRSSPRLAPLISAIGMSIFLQNYVQILQ 122 +P+ + V VA++ T+ YG+++ER+AYRPLR+S RL PLISAIGMSIFLQN V + Q Sbjct: 66 HSLPILMTVAFVATIFVTSAYGYSIERVAYRPLRNSNRLIPLISAIGMSIFLQNTVLLSQ 125 Query: 123 GARSKPLQPILPGNLTLMDGA---VSVSYVRLATIVITIALMYGFTQLITRTSLGRAQRA 179 ++ K + ++PG+ + G V +SY+++ V+T+ M T I+R+ LGRA RA Sbjct: 126 DSKDKSIPNLIPGSFSFGPGGAEEVLISYMQILVFVVTLVAMTLLTLFISRSRLGRACRA 185 Query: 180 CEQDKKMAGLLGVNVDRVISLTFVMGAALAAVAGMMVLLIYGVIDFYIGFLAGVKAFTAA 239 C +D KMA LLG+N + +I+LTFV+GAALAAVA +++ + YGVI+ GFL G+KAFTAA Sbjct: 186 CAEDIKMANLLGINTNNIIALTFVIGAALAAVAAVLLSMQYGVINPNAGFLVGLKAFTAA 245 Query: 240 VLGGIGSLPGAMLGGVVIGLIEAFWSGYMGSEWKDVATFTILVLVLIFRPTGLLGRPEIE 299 VLGGIGS+PGAMLGG+V+G+ EAF + G ++KDV F +LVLVL+FRPTG+LGRPE+E Sbjct: 246 VLGGIGSIPGAMLGGLVLGVAEAFGADIFGDQYKDVVAFGLLVLVLLFRPTGILGRPEVE 305 Query: 300 KV 301 KV Sbjct: 306 KV 307 Lambda K H 0.329 0.144 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 392 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 307 Length adjustment: 27 Effective length of query: 274 Effective length of database: 280 Effective search space: 76720 Effective search space used: 76720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory