Align Leucine/isoleucine/valine ABC transporter,permease component (characterized, see rationale)
to candidate PP_4865 PP_4865 High-affinity branched-chain amino acid transport system permease protein BraE
Query= uniprot:G8ALI9 (505 letters) >FitnessBrowser__Putida:PP_4865 Length = 435 Score = 362 bits (929), Expect = e-104 Identities = 188/372 (50%), Positives = 251/372 (67%), Gaps = 8/372 (2%) Query: 100 EALRVILIAGGAVIA---IRAVLAIRTGRSKLSQAERDKRMDHIAA-QVQHASRWLGPIA 155 E RV + GG ++ + L G+ L + H+ A + R++ P Sbjct: 53 EPRRVAWLVGGVMVGRFLLSLFLQTAPGQRMLLGFDSGGSGVHVTAPDYKSRLRYIIPAL 112 Query: 156 VVVALAFPFTPLADRQLLDIGILLLTYIMLGWGLNIVVGLAGLLDLGYVAFYAVGAYSYA 215 +V+A+ FP A++ LL + IL L Y++LG GLNIVVGLAGLLDLGYVAFYA+GAY A Sbjct: 113 IVIAIVFPI--FANKYLLTVVILGLIYVLLGLGLNIVVGLAGLLDLGYVAFYAIGAYGLA 170 Query: 216 LLAHYFGFSFWVCLPLAGFLAAMSGVLLGFPVLRLRGDYFAIVTLGFGEIIRIILINWYQ 275 L Y G FW LPLA AA++G +LGFPVLR+ GDY AIVTLGFGEIIR++L NW Sbjct: 171 LGYQYLGLGFWSVLPLAAIAAALAGCILGFPVLRMHGDYLAIVTLGFGEIIRLVLNNWLS 230 Query: 276 FTGGPNGISGIPRPSFFGIADFTRTPAEGTAAFHEMFGLEFSPLHRIIFLYYLILVLALV 335 FTGGPNG+ P P+FFG+ +F R +G HE FG E++ + +F+Y ++ ++ L Sbjct: 231 FTGGPNGMPA-PSPTFFGL-EFGRRAKDGGVPIHEFFGFEYNASLKFVFIYAVLFMVVLA 288 Query: 336 VNLFTMRVRKLPLGRAWEALREDDIACASLGINRTNMKLAAFAIAAMFGGFAGSFFATRQ 395 V R+ ++P+GRAWEALRED+IAC S+G+N +KL+AF + A G AG FFAT Q Sbjct: 289 VLYIKHRLTRMPVGRAWEALREDEIACRSMGLNHVLVKLSAFTLGASTAGLAGVFFATYQ 348 Query: 396 GFISPESFTFIESAIILAIVVLGGMGSQIGVVVAAFLVIGLPEAFRELADYRMLAFGMGM 455 GF++P SFTF ESA+ILAIVVLGGMGS +GVV+AAF++ PE R ++YR+L FG+ M Sbjct: 349 GFVNPSSFTFFESALILAIVVLGGMGSTVGVVIAAFVLTVAPELLRSFSEYRVLLFGVLM 408 Query: 456 VLIMLWRPRGLL 467 VL+M+WRPRGL+ Sbjct: 409 VLMMIWRPRGLI 420 Lambda K H 0.329 0.144 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 666 Number of extensions: 41 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 505 Length of database: 435 Length adjustment: 33 Effective length of query: 472 Effective length of database: 402 Effective search space: 189744 Effective search space used: 189744 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory