GapMind for catabolism of small carbon sources

 

Aligments for a candidate for cycA in Pseudomonas putida KT2440

Align L-alanine and D-alanine permease (characterized)
to candidate PP_0927 PP_0927 aromatic amino acid transport protein

Query= reanno::WCS417:GFF1065
         (472 letters)



>lcl|FitnessBrowser__Putida:PP_0927 PP_0927 aromatic amino acid
           transport protein
          Length = 453

 Score =  399 bits (1026), Expect = e-116
 Identities = 202/450 (44%), Positives = 292/450 (64%), Gaps = 6/450 (1%)

Query: 18  LKRELGERHIRLMALGACIGVGLFLGSAKAIEMAGPAIMLSYIIGGLAILVIMRALGEMA 77
           L+R L  RHI+L+ALG  IG GLFLG A+ I++AGP+++L Y I GL   +IMR LGEM 
Sbjct: 10  LQRGLKNRHIQLIALGGAIGTGLFLGIAQTIQLAGPSVLLGYAIAGLMAFLIMRQLGEMV 69

Query: 78  VHNPVAGSFSRYAQDYLGPLAGFLTGWNYWFLWLVTCVAEITAVAVYMGVWFPDTPRWIW 137
           V  PVAGSFS +A  Y    AGF++GWNYW ++++  +AE+TAV +Y+  W+PD P W  
Sbjct: 70  VEEPVAGSFSHFAHQYWSEFAGFVSGWNYWVVYVLVGMAELTAVGIYVQYWWPDFPTWAT 129

Query: 138 ALAALISMGSINLIAVKAFGEFEFWFALIKIVTIIAMVIGGVGIIAFGFGNDGVALGISN 197
           A    + +  INL  VK +GE EFWFAL+K+V I++M+  G G    G G+ G    ++N
Sbjct: 130 AAIFFVVINLINLTQVKVYGEMEFWFALVKVVAIVSMI--GFGAWLLGSGHGGPDASVAN 187

Query: 198 LWAHGGFMPNGVQGVLMSLQMVMFAYLGVEMIGLTAGEAKNPQKTIPSAIGSVFWRILLF 257
           LW +GGF PNGV G++M+L ++MF++ G+E++G+TA EA NP+++IP A   V +RIL+F
Sbjct: 188 LWQYGGFFPNGVTGLVMALAVIMFSFGGLELVGITAAEADNPRESIPKATNQVVYRILIF 247

Query: 258 YVGALFVILSIYPWNEIGTQGSPFVMTFERLGIKTAAGIINFVVITAALSSCNGGIFSTG 317
           Y+GAL V+LS+YPW ++   GSPFVM F  L     A I+N VV+TAALS  N  +++  
Sbjct: 248 YIGALAVLLSLYPWQKVVQGGSPFVMIFHELDSDLVATILNIVVLTAALSVYNSCVYANS 307

Query: 318 RMLYSLAQNGQAPATFAKTSSNGVPRKALLLSIFALLLGVLLNYLVPEKVFVWVTSIATF 377
           RML+ LA  G AP    K S +GVP  AL +S FA  L VL+NYL+P   F  + ++A  
Sbjct: 308 RMLFGLASQGDAPRQLLKVSRSGVPLTALAVSAFATGLCVLINYLMPGGAFGLLMALAVS 367

Query: 378 GAIWTWLMILLAQLKFRKSLSPAEQAGLKYRMWLYPVSSYLALAFLLLVVGLMAYFPDTR 437
             +  W  I +  LKFRK+   A      Y+   +P+++YL LAF++L++ +M   P  R
Sbjct: 368 ALVINWASISITHLKFRKAKLAAGITPF-YKSLGHPLTNYLCLAFIVLILVVMYLTPPIR 426

Query: 438 IALYVGPVFLVLLTVLFYVFKLQPTQVAQG 467
           I++ + P +   + VL+  FKL+  + A+G
Sbjct: 427 ISVMLIPAW---IAVLWVAFKLKKARQAKG 453


Lambda     K      H
   0.328    0.142    0.447 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 647
Number of extensions: 28
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 472
Length of database: 453
Length adjustment: 33
Effective length of query: 439
Effective length of database: 420
Effective search space:   184380
Effective search space used:   184380
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory