Align D-lactate oxidase and glycolate oxidase, FAD binding subunit (EC 1.1.3.15) (characterized)
to candidate PP_3746 PP_3746 glycolate oxidase, putative FAD-binding subunit
Query= reanno::psRCH2:GFF3771 (353 letters) >FitnessBrowser__Putida:PP_3746 Length = 350 Score = 498 bits (1281), Expect = e-145 Identities = 245/347 (70%), Positives = 281/347 (80%), Gaps = 2/347 (0%) Query: 7 DASAQLLDQVNQALAANTPLRIQGSGSKSFLGLQADGVLLDTREHRGIVSYDPTELVVTV 66 D S LL+QVNQAL TPLRIQGS SK+ LG G +LDTR+HRGIVSYDPTELV+T Sbjct: 6 DMSQTLLEQVNQALNEGTPLRIQGSNSKAMLGNPVAGEVLDTRKHRGIVSYDPTELVLTA 65 Query: 67 RAGTPLTELETALDEAGQMLPCEPPHFGEGATVGGMIAAGLSGPRRPWSGSVRDFVLGSR 126 RAGTPL E+E AL EAGQMLPCEPPH G AT+GGM+AAGLSGPRRPW+GSVRDFVLG+R Sbjct: 66 RAGTPLREIEAALHEAGQMLPCEPPHLGPEATLGGMVAAGLSGPRRPWAGSVRDFVLGTR 125 Query: 127 VITGQGKHLRFGGEVMKNVAGYDLSRLMAGSFGCLGVLTEVSLKVLPKPRLCTSLRLEID 186 VITG GK LRFGGEVMKNVAGYD+SRLMAGSFGCLG+LTEVSLKVLP+PRLC SLRL + Sbjct: 126 VITGHGKLLRFGGEVMKNVAGYDVSRLMAGSFGCLGLLTEVSLKVLPRPRLCLSLRLAMG 185 Query: 187 LERALLKLAEWGQQPIPISAASHDGQALHLRLEGGEGSVGAARERIGGEDLDPGYWNDLR 246 AL +LAEWGQQ +PISAA H+G+ L+LRLEGGEGSV +AR+R+GG+ LD +W+DLR Sbjct: 186 RNEALAELAEWGQQSLPISAACHEGETLYLRLEGGEGSVQSARQRLGGDTLDNRFWSDLR 245 Query: 247 EQRLAFFADPRPLWRLSLPNNTPALGLPGDQLVDWAGAQRWLKSDADAVTIRGIAIEVGG 306 EQRLAFFAD PLWRLS+P T L LPG QL+DW GAQRWLK+ A A IR VGG Sbjct: 246 EQRLAFFADAAPLWRLSVPTVTGELDLPGQQLLDWGGAQRWLKTCASAQAIRDQVARVGG 305 Query: 307 HATCFTAGATTNPFQPLAAPLLRYHRQLKAALDPQGIFNPGRMYSEV 353 HATC+ GA ++P PL L+RYHR LK LDPQG+FNPGR+Y ++ Sbjct: 306 HATCYAPGAASSP--PLPVALMRYHRALKQQLDPQGVFNPGRLYPDL 350 Lambda K H 0.319 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 484 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 350 Length adjustment: 29 Effective length of query: 324 Effective length of database: 321 Effective search space: 104004 Effective search space used: 104004 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory