Align Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 (characterized)
to candidate PP_4430 PP_4430 putative threonine dehydratase
Query= SwissProt::Q7XSN8 (339 letters) >FitnessBrowser__Putida:PP_4430 Length = 330 Score = 183 bits (464), Expect = 6e-51 Identities = 103/306 (33%), Positives = 175/306 (57%), Gaps = 9/306 (2%) Query: 27 AQARIAPYVHKTPVLSSTSIDAIVGKQLFFKCECFQKAGAFKIRGASNSIFALDDDEASK 86 A+ RI V +T + S S+ + ++ K EC Q G+FK+RGA+N+I L + + Sbjct: 12 ARDRIKHLVRETRMELSPSLSDFMKVPVYLKLECHQATGSFKLRGATNAIAGLTSQQRAL 71 Query: 87 GVVTHSSGNHAAAVALAAKLRGIPAYIVIPRNAPACKVDNVKRYGGHIIWSDVSIESRES 146 GVVT S+GNH A++ AA G+ A + + R P+ KV ++ G + S + + Sbjct: 72 GVVTASTGNHGRALSYAAAAAGVRATVCLSRLVPSNKVAAIRALGAAVQVVGNSQDDAQF 131 Query: 147 VAKRVQEETGAILVHPFNNKNTISGQGTVSLELLEEVPEIDTIIVPISGGGLISGVALAA 206 A R+ +E G + PF++++ I+GQ T+ LE+ E++P + +++P+SGGGL SGV+LA Sbjct: 132 EAARLAQEEGLTFIPPFDHQDVIAGQATLGLEIAEQLPSVSQVLIPLSGGGLFSGVSLAL 191 Query: 207 KAINPSIRILAAEPKGADDSAQSKAAGKIITLPSTNTIADGLRAFLG---DLTWPVVRDL 263 KA+ P ++ + AQS AGK + + T+AD L +G T+ + R Sbjct: 192 KALLPQVKTHGVSMRLGAAMAQSLEAGKPVNVEEVATLADSLGGGIGLRNQYTFELTRRF 251 Query: 264 VDDIIVVDDNAIVDAMKMCYEMLKVAVEPSGAIGLAAALSDEFKQSSAWHESSKIGIIVS 323 +D +I++++++I DAM Y ++ +E +GA+G+AA L+ + + I I+VS Sbjct: 252 IDRVILLNEDSIADAMLHAYLEERLVIEGAGAVGIAALLTRQVE------AQGPIVIVVS 305 Query: 324 GGNVDL 329 GGNVD+ Sbjct: 306 GGNVDM 311 Lambda K H 0.316 0.133 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 215 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 330 Length adjustment: 28 Effective length of query: 311 Effective length of database: 302 Effective search space: 93922 Effective search space used: 93922 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory