Align ABC transporter for N-Acetyl-D-glucosamine, permease protein 2 (characterized)
to candidate PP_1017 PP_1017 mannose/glucose ABC transporter, permease protein
Query= reanno::Smeli:SMc02871 (279 letters) >FitnessBrowser__Putida:PP_1017 Length = 281 Score = 134 bits (337), Expect = 2e-36 Identities = 81/268 (30%), Positives = 135/268 (50%), Gaps = 4/268 (1%) Query: 13 AVHAALIAYTLIALFPVFLTIVNSFKSRNAIFREPLAVPTPETFSLIGYETVLKQGDFIG 72 A+HA L+ L+ L P+ + ++ SFK+ I L + P + IG+ V G G Sbjct: 16 AIHAVLLIAVLLYLVPLVVMLLTSFKTPEDITTGNL-LSWPAVITGIGW--VKAWGAVSG 72 Query: 73 YFQNSIIVTVVSIALVLLFGAMAAFALSEYRFRGNTLMGLYLALGIMIPIRLGTVAILQG 132 YF NSI++TV ++ + GA+ + LS +RFRG+ L L G +P + + Sbjct: 73 YFWNSIMITVPAVLISTAIGALNGYVLSMWRFRGSQLFFGLLLFGCFLPFQTVLLPASFT 132 Query: 133 MVATGLVNTLTALILVYTAQGLPLAVFILSEFMRTVSDDLKNAGRIDGLSEYAIFLRLVL 192 + GL +T L+LV+ GL F ++ D L A R+DG + IF R++L Sbjct: 133 LGKLGLASTTGGLVLVHVVYGLAFTTLFFRNFYVSIPDALVKAARLDGAGFFTIFRRIIL 192 Query: 193 PLIRPAMATVAVFTMIPIWNDLWFPLILAPAEATK-TVTLGSQIFIGQFVTNWNAVLSAL 251 P+ P + ++ IWND F ++ + ++ TV L + + +N ++A Sbjct: 193 PMSTPIIMVCLIWQFTQIWNDFLFGVVFSSGDSQPITVALNNLVNTSTGAKEYNVDMAAA 252 Query: 252 SLAIFPVLVLYVIFSRQLIRGITAGAVK 279 +A P L++YV+ + +RG+TAGAVK Sbjct: 253 MIAGLPTLLVYVVAGKYFVRGLTAGAVK 280 Lambda K H 0.330 0.142 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 251 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 279 Length of database: 281 Length adjustment: 26 Effective length of query: 253 Effective length of database: 255 Effective search space: 64515 Effective search space used: 64515 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory