Align Organic acid uptake porter, DctA of 444 aas and 8 - 10 putative TMSs (characterized)
to candidate PP_2056 PP_2056 C4-dicarboxylate transport protein
Query= TCDB::Q848I3 (444 letters) >FitnessBrowser__Putida:PP_2056 Length = 435 Score = 459 bits (1181), Expect = e-134 Identities = 229/425 (53%), Positives = 314/425 (73%), Gaps = 1/425 (0%) Query: 7 LYKSLYFQVIVAIAIGILLGHFYPQTGVALKPLGDGFIKLIKMVIAPIIFCTVVSGIAGM 66 L KSLYFQ++ A+ +G+++GHF+ Q VALKPLGD FIKLIKM+IAP++FCT+V+GIAGM Sbjct: 3 LAKSLYFQILCAVLLGVVVGHFWAQQAVALKPLGDAFIKLIKMMIAPVVFCTIVTGIAGM 62 Query: 67 QNMKSVGKTGGYALLYFEIVSTIALLIGLVVVNVVQPGNGMHIDVSTLDASKVAAYVTAG 126 + +S+G+ LL F ++ ++L+IGL V + +PG GM+ID +TL + ++ Y + Sbjct: 63 TDKRSLGRLMSKTLLLFLGLTVVSLVIGLAAVYLFKPGAGMNIDPATLSTAGLSQYTASA 122 Query: 127 KDQSIVGFILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGAYGKPVLDFIDRFAHV 186 S+V F +++IP+T +GAF G++L VL +V+ GFAL +G GKPVLD ++ + + Sbjct: 123 AKLSVVDFFMHIIPDTFIGAFNKGEVLPVLFIAVLSGFALSSMGEKGKPVLDVLESASTM 182 Query: 187 MFNIINMIMKLAPIGALGAMAFTIGAYGVGSLVQLGQLMICFYITCVLFVLVVLGAICRA 246 +F I +M+ APIGA GA+AFT+G YG+ SL L +L+ YI C FVLVVLG ICRA Sbjct: 183 VFRIFGYLMRFAPIGAFGALAFTVGQYGITSLGALAKLVGTLYIACAFFVLVVLGGICRA 242 Query: 247 HGFSVLKLIRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVIPTGYSFNLDG 306 HGFS+ KL+RY REE L+VLGTSS+E LPRML K+E+LG KK VVGLV+PTGYSFNLDG Sbjct: 243 HGFSLWKLLRYFREEFLVVLGTSSTEPVLPRMLEKLEKLGCKKGVVGLVLPTGYSFNLDG 302 Query: 307 TSIYLTMAAVFIAQATDTHMDITHQITLLLVLLLSSKGAAGVTGSGFIVLAATLSAVGHL 366 T+IYL++AAVFIAQA + + + +T+L ++LLSSKGAAGVTGSGF+ LA+TL+ + + Sbjct: 303 TAIYLSLAAVFIAQACNIDLSLGQVVTMLAIMLLSSKGAAGVTGSGFVALASTLTVIHDI 362 Query: 367 PVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVKELDEDQLQAELASGGRAISDT 426 P+AGLAL++G+DRFMSEARALT+L NAVATVVV+ D L + L +G ++ Sbjct: 363 PLAGLALLIGVDRFMSEARALTSLASNAVATVVVSLSENACDRQTLHSRL-NGEPVVTPV 421 Query: 427 REEDD 431 E D Sbjct: 422 AETAD 426 Lambda K H 0.326 0.142 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 575 Number of extensions: 31 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 444 Length of database: 435 Length adjustment: 32 Effective length of query: 412 Effective length of database: 403 Effective search space: 166036 Effective search space used: 166036 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory