GapMind for catabolism of small carbon sources

 

Aligments for a candidate for deh in Pseudomonas putida KT2440

Align Acetate/haloacid transporter, Dehp2, with a possible atypical topology (characterized)
to candidate PP_0057 PP_0057 major facilitator family transporter

Query= TCDB::F8SVK1
         (552 letters)



>lcl|FitnessBrowser__Putida:PP_0057 PP_0057 major facilitator family
           transporter
          Length = 539

 Score =  674 bits (1739), Expect = 0.0
 Identities = 324/543 (59%), Positives = 419/543 (77%), Gaps = 15/543 (2%)

Query: 6   GQISHAPMTKEEKRVIFASSLGTVFEWYDFYLAGSLAAFISKSFFSGVNPTAAFIFTLLG 65
           G  + +   +EE+++IFASSLGTVFEWYDF+L G+LAA ISK FF+GVN T AFIF L+ 
Sbjct: 9   GAAASSSSRREERKIIFASSLGTVFEWYDFFLYGALAAVISKQFFAGVNDTTAFIFALMA 68

Query: 66  FAAGFAVRPFGALVFGRLGDMVGRKYTFLITIVIMGLSTCVVGFLPGYAAIGMASPVIFI 125
           FAAGF VRPFGALVFGRLGDM+GRKYTFL+TIV+MGLST  VG LP YA+IG+A+P+I +
Sbjct: 69  FAAGFLVRPFGALVFGRLGDMIGRKYTFLVTIVLMGLSTFAVGLLPTYASIGIAAPIILV 128

Query: 126 AMRLLQGLALGGEYGGAATYVAEHAPANRRGFYTAWIQTTATLGLFLSLLVILGVRTAMG 185
            +R+LQGLALGGEYGGAATYVAEHAP  +RG +T +IQ+TATLGL LSLLV+LG R   G
Sbjct: 129 ILRMLQGLALGGEYGGAATYVAEHAPPGKRGLHTGFIQSTATLGLLLSLLVVLGSRYISG 188

Query: 186 EDAFGAWGWRIPFVASLVLLGISVWIRMQLHESPAFERIKAEGKTSKAPLSEAFGQWKNL 245
            D F  WGWR+PF+ S+VLL IS WIRM +HESPAF ++KA+GK SK+P+ E+F  W NL
Sbjct: 189 -DQFETWGWRLPFLLSIVLLAISTWIRMSMHESPAFVKMKAQGKVSKSPIRESFTSWPNL 247

Query: 246 KIVILALIGVTAGQAVVWYTGQFYALFFLTQTLKVDGASANILIAIALLIGTPFFLFFGS 305
           K+V+ AL  + AGQAV +YT QFY LFF+TQ LK+D A AN L+ I+++IG PFF+FFG 
Sbjct: 248 KVVLTALFSINAGQAVTFYTAQFYVLFFMTQMLKMDSAQANTLLIISVVIGAPFFVFFGW 307

Query: 306 LSDRIGRKPIILAGCLIAALTYFPLFKALTHYANPALEAATQKSPIVVIANPDECSFQFN 365
           LSDRIGRKPI++ G L+A + YFPLFKAL+HYANP ++AA++++PIVV A+P  C+FQF+
Sbjct: 308 LSDRIGRKPILMLGLLLATVLYFPLFKALSHYANPQIDAASRQAPIVVTADPQGCTFQFD 367

Query: 366 PVGTSKFTSSCDIAKSALSKAGLNYDNVAAPAGTLAQIKVGDTTIDTYDGKAADAKDAGK 425
           PVG ++F S CD  K+ L K GL Y +V+  AG+   + +GD TI+ +D  A  A     
Sbjct: 368 PVGKARFDSPCDKVKTFLVKQGLPYSSVSV-AGSEVVVNIGDKTINGFDETAMRA----- 421

Query: 426 AFDKNLGTALKAASYPPKADPSQLNWPMTVVILTILVIYVTMVYGPIAAMLVEMFPTRIR 485
                   A++ A YP KADP+Q+N  M VV++  +++  TM YGP+AA++VE+FPTRIR
Sbjct: 422 --------AIEQAGYPAKADPAQVNQVMVVVLIVAMILIATMTYGPLAAVMVELFPTRIR 473

Query: 486 YTSMSLPYHIGNGWFGGFLPATAFAIVAAKGNIYSGLWYPIIIALATFVIGLLFVRETKD 545
           YTSMSLPYHIGNGWFGGFLP  +FA+V   G+I+ GLWYP+++   + V+G+  +RETKD
Sbjct: 474 YTSMSLPYHIGNGWFGGFLPTVSFALVVYTGDIFYGLWYPVLVTGISLVVGIFCLRETKD 533

Query: 546 SNI 548
            +I
Sbjct: 534 VDI 536


Lambda     K      H
   0.325    0.139    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 799
Number of extensions: 37
Number of successful extensions: 10
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 552
Length of database: 539
Length adjustment: 35
Effective length of query: 517
Effective length of database: 504
Effective search space:   260568
Effective search space used:   260568
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory