Align glycolaldehyde oxidoreductase small subunit (characterized)
to candidate PP_2477 PP_2477 isoquinoline 1-oxidoreductase subunit alpha
Query= metacyc::MONOMER-18073 (163 letters) >FitnessBrowser__Putida:PP_2477 Length = 153 Score = 105 bits (262), Expect = 3e-28 Identities = 53/139 (38%), Positives = 77/139 (55%) Query: 16 VNGVLYERYVSPRILLVDFLREELGLTGTKIGCDTTTCGACTVLLNGKSVKSCTLFAVQA 75 +NG + V+P + L+ LR+ LGLTGTK GC CG CTV L+G+ ++SC Sbjct: 6 INGQSQQVDVAPDMPLLWVLRDVLGLTGTKYGCGIAQCGVCTVHLDGQPIRSCVTPISAV 65 Query: 76 DGAEITTIEGLSVDSKLHPIQEAFKENFALQCGFCTPGMIMQAYFLLKENPNPSEEEVRD 135 G ITTIE + +Q+A+ + +QCG+C G IM A LL+ P P ++ + Sbjct: 66 AGRAITTIEAIGETVVGQAVQQAWLAHEVVQCGYCQSGQIMAATALLQRQPKPDDQAIDA 125 Query: 136 GLHGNICRCTGYQNIVKAV 154 + GN+CRC Y I A+ Sbjct: 126 AMAGNLCRCATYTRIRTAI 144 Lambda K H 0.322 0.138 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 78 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 163 Length of database: 153 Length adjustment: 17 Effective length of query: 146 Effective length of database: 136 Effective search space: 19856 Effective search space used: 19856 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory