Align L-arabinose 1-dehydrogenase; D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate PP_2794 PP_2794 Oxidoreductase, short chain dehydrogenase/reductase family
Query= reanno::BFirm:BPHYT_RS16920 (266 letters) >FitnessBrowser__Putida:PP_2794 Length = 255 Score = 98.6 bits (244), Expect = 1e-25 Identities = 76/249 (30%), Positives = 120/249 (48%), Gaps = 6/249 (2%) Query: 17 ARYPSLVDRTVLITGGATGIGASFVEHFAAQGARVAFFDIDASAGEALADELGDSKHKPL 76 AR +L R L+TG ++G+G F AA GA V + +AL + + + + Sbjct: 6 ARLFALDGRRALVTGASSGLGRHFAMTLAAAGAEVVVTARRQAPLQALVEAIEVAGGRAQ 65 Query: 77 FLSCDLTDIDALQKAIADVKAALGPIQVLVNNAANDKRHTIGEVTRESFDAGIAVNIRHQ 136 + D+T ++ I V A GP+ VLVNNA + +++D + N++ Sbjct: 66 AFALDVTS----REDICRVLDAAGPLDVLVNNAGVSDSQPLLACDDQTWDHVLDTNLKGA 121 Query: 137 FFAAQAVMEDMKAANSG-SIINLGSISWMLKNGGYPVYVMSKSAVQGLTRGLARDLGHFN 195 + AQ M A G S+IN+ SI G Y+ +K+ + LTR +A +L Sbjct: 122 WAVAQESARRMVVAGKGGSLINVTSILASRVAGAVGPYLAAKAGLAHLTRAMALELARHG 181 Query: 196 IRVNTLVPGWVMTEKQKRLWLDDAGRRSIKEGQCIDAELEPADLARMALFLAADDSRMIT 255 IRVN L PG+VMT+ + +AG + ++ P+DL L LA+D R ++ Sbjct: 182 IRVNALAPGYVMTDLNEAFLASEAGDK-LRSRIPSRRFSVPSDLDGALLLLASDAGRAMS 240 Query: 256 AQDIVVDGG 264 +IVVDGG Sbjct: 241 GAEIVVDGG 249 Lambda K H 0.320 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 173 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 255 Length adjustment: 24 Effective length of query: 242 Effective length of database: 231 Effective search space: 55902 Effective search space used: 55902 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory