Align Gluconolactonase (characterized, see rationale)
to candidate PP_1170 PP_1170 Gluconolactonase
Query= uniprot:A0A165IRV8 (316 letters) >FitnessBrowser__Putida:PP_1170 Length = 293 Score = 166 bits (421), Expect = 5e-46 Identities = 106/294 (36%), Positives = 143/294 (48%), Gaps = 11/294 (3%) Query: 28 VIALGNALGEGVLWSVREQAVYWVDILGRELHRWDPATGAHQRWTFDEEISAIAERAHAP 87 ++ N GE +W EQA+YWVDI R+LHRW A G HQ W DE ++ IA Sbjct: 6 IVDARNGTGESPVWHPGEQALYWVDIPARQLHRWQAADGKHQCWQGDEMLACIARSGQ-- 63 Query: 88 GFIVTLRRGFALFDPATD--MAPRYLHQPEPDRAGNRFNDGKCDAQGRFWAGSM--DFAC 143 G++ + G D + R L + +AG RFNDG+CD QGRFWAG+M D Sbjct: 64 GWVAGMESGIFQLQAKADGSLDSRLLSNVQHAQAGMRFNDGRCDRQGRFWAGTMLLDMQQ 123 Query: 144 EAPTGALYRYDSDGSCTRHDDGFAVTNGPTWSGTGQGAAMFFNATIEGNTYRYDSDLATG 203 A GALYR+D +G DG V NG +S G+ + + + +D D +G Sbjct: 124 GAHVGALYRHDGEGHLHLQQDGMIVPNGLAFSPDGKRMYLSDSHPNVQKVWAFDYDTDSG 183 Query: 204 TVSNKTLWKHWLPEDGLPDGMTTDAQGRLWIAHWGGWCVTCHDPVTAAELGR-VRLPVSQ 262 T K L+ G PDG D G WI G H L R + +PV + Sbjct: 184 TPHGKHLFVDMRNYPGRPDGAAIDQDGCYWIC--GNDAGQIHRFTPEGRLDRSLSVPVKK 241 Query: 263 VTTCAFGGADLRTLFISSARVGLTPEQLAAEPLAGALFAVDTDSLGLPAHPFGG 316 CAFGGA L L+++S R T L+ +PLAG +FA+D + GL + G Sbjct: 242 PAMCAFGGASLDILYVTSIRP--TGIDLSDQPLAGGVFALDPGTKGLEEPAYRG 293 Lambda K H 0.321 0.137 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 406 Number of extensions: 26 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 293 Length adjustment: 27 Effective length of query: 289 Effective length of database: 266 Effective search space: 76874 Effective search space used: 76874 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory