GapMind for catabolism of small carbon sources

 

Aligments for a candidate for xacD in Pseudomonas putida KT2440

Align L-arabonate dehydratase; L-arabinonate dehydratase; EC 4.2.1.25 (characterized)
to candidate PP_1010 PP_1010 phosphogluconate dehydratase

Query= SwissProt::Q1JUQ1
         (583 letters)



>lcl|FitnessBrowser__Putida:PP_1010 PP_1010 phosphogluconate
           dehydratase
          Length = 608

 Score =  200 bits (508), Expect = 2e-55
 Identities = 158/516 (30%), Positives = 248/516 (48%), Gaps = 48/516 (9%)

Query: 44  IGICNTWSELTPCNAHFRKLAEHVKRGISE-------AGGFPVEFPVFSNGESNLRPSAM 96
           + I + ++++   +  +    E +K+ + E       AGG P      + GE  +   A+
Sbjct: 68  VAIVSAYNDMLSAHQPYLHFPEQIKQALREVGSVGQFAGGVPAMCDGVTQGEPGME-LAI 126

Query: 97  LTRNLASMDVEEAIRGNPIDAVVLLAGCDKTTPALLMGAASCD-VPAIVVSGGPMLNGKL 155
            +R + +M    A+  N  DA ++L  CDK  P L+MGA     +P I V GGPM++G  
Sbjct: 127 ASREVIAMSTAVALSHNMFDAALMLGICDKIVPGLMMGALRFGHLPTIFVPGGPMVSGI- 185

Query: 156 EGKNIGSGTAVWQLHEALKAGEIDVHHFLSAEAGMSRSAGTCNTMGTASTMACMAEALGV 215
                 S      + +    G+      L +E     S GTC   GTA+T   + E +G+
Sbjct: 186 ------SNKQKADVRQRYAEGKASREELLESEMNSYHSPGTCTFYGTANTNQLVMEVMGL 239

Query: 216 ALPHNAAIPAVDSRRYVLAHMSGIRIVEMALEG---LVLSKILTRAAFENAIRANAAIGG 272
            LP  + +      R  L   +  ++  M       + L +I+   A  N+I A  A GG
Sbjct: 240 HLPGASFVNPYTPLRDALTAEAAQQVTRMTKASGSFMPLGEIVDEKALVNSIVALHATGG 299

Query: 273 STNAVIHLKAIAGRIGVPLELEDWMRIGRDTPTIVDLMPSGRFPMEEFYYAGGLPAVLRR 332
           STN  +H+ AIA   G+ L  +D   +    PT+  + P+G+  +  F  AGG+  ++R 
Sbjct: 300 STNHTLHIPAIAQAAGIQLTWQDMADLSEVVPTLSHVYPNGKADINHFQAAGGMAFLIRE 359

Query: 333 LGEGGLLPNPDALTV---------------NGKSLWDNVREAPNY--DEEVIRPLDRPLI 375
           L + GLL + D  TV               NGK +W   RE P +  DE ++RP+ RP  
Sbjct: 360 LLDAGLL-HEDVNTVAGHGLRRYTQEPFLDNGKLVW---REGPQHSLDESILRPVSRPFS 415

Query: 376 ADGGIRILRGNLAPRGAVLKPSAASPELLKHRGRAVVFENLDHYKATINDEALDIDASSV 435
           A+GG+R++ GNL  RG V+K SA +PE       A VF+  D        +A +++   V
Sbjct: 416 AEGGLRVMEGNLG-RG-VMKVSAVAPEHQVVEAPARVFQ--DQQSLADAFKAGELERDFV 471

Query: 436 MVLKNCGPRGYPGMAEVGNMGLPPKLLRQGVKDMVRISDARMSGTAYGTV--VLHVAPEA 493
            V++  GPR   GM E+  +     +L+     +  ++D RMSG A G +   +HV PEA
Sbjct: 472 AVVRFQGPR-CNGMPELHKLTPFLGVLQDRGYKVALVTDGRMSG-ASGKIPAAIHVCPEA 529

Query: 494 AAGGPLAAVRNGDWIELDCEAGTLHLDITDDELHRR 529
             GGPLA VR+GD + +D   GTL + ++ +EL  R
Sbjct: 530 YDGGPLARVRDGDIVRVDGVEGTLRIMVSAEELASR 565


Lambda     K      H
   0.319    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 827
Number of extensions: 46
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 583
Length of database: 608
Length adjustment: 37
Effective length of query: 546
Effective length of database: 571
Effective search space:   311766
Effective search space used:   311766
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory