Align Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale)
to candidate PP_5137 PP_5137 ferric iron ABC transporter, ATP-binding protein
Query= uniprot:D4GP38 (383 letters) >FitnessBrowser__Putida:PP_5137 Length = 352 Score = 223 bits (569), Expect = 5e-63 Identities = 116/235 (49%), Positives = 162/235 (68%), Gaps = 3/235 (1%) Query: 3 QIQLTDLTKRFGDTVAVDDLSLDIDDEEFLVLVGPSGCGKSTTLRMLAGLETPTSGDIYI 62 QI++ ++ KRFG A++D+SLDI E + L+GPSGCGK+T LR +AGLE G +YI Sbjct: 9 QIKVRNIHKRFGAFTALNDVSLDIAAGELVCLLGPSGCGKTTLLRCIAGLERQDRGTLYI 68 Query: 63 GGDHMNYRVPQNRDIAMVFQDYALYPHMTVRQNIRFGLEEEEGYTSAERDERVVEVAETL 122 G ++ PQ RD ++FQ YAL+P++TV NI +GL G + +RV E+ E + Sbjct: 69 GERDISDLSPQARDYGILFQSYALFPNLTVEANIAYGLT---GSGREQARQRVAEMLELV 125 Query: 123 GIADLLDRKPDELSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRTELQNLQD 182 G++ + P +LSGGQQQRVAL RA+ P + L+DEP+S LDA++R + TEL+ LQ Sbjct: 126 GLSGSEKKYPGQLSGGQQQRVALARALAPSPSLLLLDEPMSALDARVREHLCTELRQLQR 185 Query: 183 QLAVTTVYVTHNQTEAMTMADRIAVMDDGELQQVASPFECYHEPNNLFVAEFIGE 237 QL +TT+ VTHNQ EAM MADRIAVM++G+++Q A+P E Y P FVAEF+G+ Sbjct: 186 QLGITTLMVTHNQDEAMLMADRIAVMNNGQVEQYATPQEIYDHPATPFVAEFVGQ 240 Lambda K H 0.317 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 352 Length adjustment: 30 Effective length of query: 353 Effective length of database: 322 Effective search space: 113666 Effective search space used: 113666 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory