Align N-carbamoylputrescine amidase; EC 3.5.1.53 (characterized)
to candidate PP_0382 PP_0382 5-aminopentanamidase
Query= SwissProt::Q9XGI9 (300 letters) >FitnessBrowser__Putida:PP_0382 Length = 264 Score = 104 bits (259), Expect = 2e-27 Identities = 84/270 (31%), Positives = 130/270 (48%), Gaps = 25/270 (9%) Query: 20 DVSTNVATAERLVRAAHQKGANIILIQELF-EGYYFCQAQKEEFFHRAKPYPGHPTIVRM 78 DV N+ + A +GA +++ E+F GY AQ E A P + + Sbjct: 14 DVPGNLQRLRHQAQLAADRGAQLLVCPEMFLSGYNIGLAQVERLAEAADG----PAAMTV 69 Query: 79 QNLAKELGVVIPVSFFEEANN-AHYNSVAIIDADGTDLGLYRKSHIPDGPGYQEKYYFNP 137 +A+ + I + E ++ A YNSV +IDA G L YRK+H+ G ++ F+P Sbjct: 70 VEIAQAHRIAIVYGYPERGDDGAIYNSVQLIDAHGRSLSNYRKTHLF---GELDRSMFSP 126 Query: 138 GDTGFKVFQTKYAKIGVAICWDQWFPEAARAMALQGAEVLFYPTAIGSEPQDDGLDSRDH 197 G F V + + K+G+ IC+D FPE AR +AL GAE++ PTA P D Sbjct: 127 GADHFPVVELEGWKVGLLICYDIEFPENARRLALDGAELILVPTA-NMTPYDFTC----- 180 Query: 198 WRRVMQGHAGANVVPLVASNRIGKEIIETEHGNSEITFYGYSFIAGPTGELVAAAGDKEE 257 + ++ A N LV +N G E EI + G S I GP G L+A AG ++E Sbjct: 181 -QVTVRARAQENQCYLVYANYCGAE--------DEIEYCGQSSIIGPDGSLLAMAG-RDE 230 Query: 258 AVLVAQFDLDKIKSKRHGWGVYRDRRPDLY 287 L+A+ + +++ R + D R +L+ Sbjct: 231 CQLLAELEHERVVQGRRAFPYLTDLRQELH 260 Lambda K H 0.319 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 233 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 264 Length adjustment: 26 Effective length of query: 274 Effective length of database: 238 Effective search space: 65212 Effective search space used: 65212 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory