Align Amino acid (Lysine/arginine/ornithine/histidine/octopine) ABC transporter membrane protein, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)
to candidate PP_0226 PP_0226 sulfur compound ABC transporter - permease subunit
Query= TCDB::Q9HU29 (230 letters) >FitnessBrowser__Putida:PP_0226 Length = 222 Score = 126 bits (317), Expect = 3e-34 Identities = 74/215 (34%), Positives = 119/215 (55%), Gaps = 9/215 (4%) Query: 5 ELILKWMPKMLQGAALTLELLAIAVVAGLALALPLGIARASRHWYVRAVPYAYIFFFRGT 64 +L++ P +L+GA T+ L + GL L L + R S+ + + Y+ FFRGT Sbjct: 7 QLVVDSAPFLLKGAGYTVLLSVGGMFFGLVLGFALALMRLSKILPLNWLARVYVSFFRGT 66 Query: 65 PLLLQLFIVYYGLAQFEEVRKSAFWPYLRDPYWCALLTMTLHTAAYIAEILRGAIHSVPV 124 PLL+QLF++Y+G+ Q DP +L+ ++L+ AAYI EILR AI S+ Sbjct: 67 PLLVQLFVIYFGMPQIG---------IELDPIPASLIGLSLNMAAYICEILRAAISSIDR 117 Query: 125 GEVEAARALGMSRRQALWHIILPRAVRIGLPAYSNEVILMLKASAVVYTVTLFDIMGMAR 184 G+ EAA ++GM+R QA+ ILP+A+R LP N I ++K +A+ T+ + ++ A+ Sbjct: 118 GQWEAAASIGMTRVQAMRRAILPQALRTALPPLGNSFISLVKDTALAATIQVPELFRQAQ 177 Query: 185 TIIARTYESMLFFCLAGALYLVITIVLTRIFRLIE 219 I ART+E + +Y V+ +L +E Sbjct: 178 LITARTFEVFTMYVAVAVIYWVLCSILAHFQNRME 212 Lambda K H 0.332 0.142 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 131 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 230 Length of database: 222 Length adjustment: 22 Effective length of query: 208 Effective length of database: 200 Effective search space: 41600 Effective search space used: 41600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory