Align Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)
to candidate PP_0225 PP_0225 sulfur compound ABC transporter - ATP-binding subunit
Query= TCDB::Q9HU32 (257 letters) >FitnessBrowser__Putida:PP_0225 Length = 252 Score = 258 bits (658), Expect = 1e-73 Identities = 133/246 (54%), Positives = 173/246 (70%), Gaps = 5/246 (2%) Query: 8 LEIRNLHKRYGDLEVLKGISLTARDGDVISILGSSGSGKSTFLRCINLLENPHQGQILVS 67 +E++ L KR+ VL GI LT + G+V++I+G SGSGK+TFLRC+NLLE P GQI + Sbjct: 2 IEVKGLTKRFKGQTVLNGIDLTVQPGEVVAIIGPSGSGKTTFLRCLNLLETPDAGQIQIG 61 Query: 68 GEELRLKKSKNGDLVAADSQQINRLRSELGFVFQNFNLWPHMSILDNVIEAPRRVLGKSK 127 + + G A I RLR + GFVFQNFNL+PH + L+NVIE P V + Sbjct: 62 AISIDANRPLGGQQSA-----IRRLRQQAGFVFQNFNLFPHRTALENVIEGPVIVKKTPR 116 Query: 128 AEAIEIAEGLLAKVGIADKRHSYPAQLSGGQQQRAAIARTLAMQPKVILFDEPTSALDPE 187 +AIE+ LLAKVG+A K +YP +LSGGQQQR AIAR LAM+P+VILFDEPTSALDPE Sbjct: 117 EQAIELGRRLLAKVGLAGKEDAYPRRLSGGQQQRVAIARALAMEPEVILFDEPTSALDPE 176 Query: 188 MVQEVLNVIRALAEEGRTMLLVTHEMSFARQVSSEVVFLHQGLVEEQGTPQQVFENPQSA 247 +V EVL IR LAEE RTM++VTHEMSFAR V++ V+F +G++ EQG + +F P+ Sbjct: 177 LVGEVLATIRGLAEEKRTMIIVTHEMSFARDVANRVIFFDKGVIVEQGEAKALFAAPKEE 236 Query: 248 RCKQFM 253 R +QF+ Sbjct: 237 RTRQFL 242 Lambda K H 0.317 0.133 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 187 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 252 Length adjustment: 24 Effective length of query: 233 Effective length of database: 228 Effective search space: 53124 Effective search space used: 53124 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory