Align Arginine transport ATP-binding protein ArtM (characterized)
to candidate PP_5022 PP_5022 Glutamine transport ATP-binding protein GlnQ
Query= SwissProt::P54537 (240 letters) >FitnessBrowser__Putida:PP_5022 Length = 244 Score = 277 bits (708), Expect = 2e-79 Identities = 144/244 (59%), Positives = 176/244 (72%), Gaps = 4/244 (1%) Query: 1 MIKVEKLSKSFGKH----EVLKNISTTIAEGEVVAVIGPSGSGKSTFLRCLNLLEKPNGG 56 MI+V L K F + N++T +A+GEVV V+GPSGSGKSTFLRCLN LE + G Sbjct: 1 MIEVRDLLKVFDTRGQVVRAVDNVTTQVAKGEVVVVLGPSGSGKSTFLRCLNGLEHFDQG 60 Query: 57 TITIKDTEITKPKTNTLKVRENIGMVFQHFHLFPHKTVLENIMYAPVNVKKESKQAAQEK 116 + I ++ PKT+ R +GMVFQHF+LFPH TVLEN+ A V+K +K + K Sbjct: 61 HVAIDGLQLADPKTDINAYRREVGMVFQHFNLFPHMTVLENLCLAQKVVRKRNKADREAK 120 Query: 117 AEDLLRKVGLFEKRNDYPNRLSGGQKQRVAIARALAMNPDIMLFDEPTSALDPEMVKEVL 176 A LL KVG+ +K N+YP+RLSGGQ+QRVAIARALAM+P +MLFDEPTSALDPEMV EVL Sbjct: 121 ARALLEKVGISQKANEYPSRLSGGQQQRVAIARALAMDPKVMLFDEPTSALDPEMVGEVL 180 Query: 177 QVMKELVETGMTMVIVTHEMGFAKEVADRVLFMDQGMIVEDGNPKEFFMSPKSKRAQDFL 236 VMK L + GMTMV VTHEMGFA+EVADRVLF D G ++ED P FF +PK RAQ FL Sbjct: 181 DVMKTLAQEGMTMVCVTHEMGFAREVADRVLFFDHGKLLEDSAPAAFFAAPKDPRAQAFL 240 Query: 237 EKIL 240 ++L Sbjct: 241 RQVL 244 Lambda K H 0.317 0.134 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 213 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 244 Length adjustment: 23 Effective length of query: 217 Effective length of database: 221 Effective search space: 47957 Effective search space used: 47957 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory