Align arginine-pyruvate transaminase (EC 2.6.1.84) (characterized)
to candidate PP_0858 PP_0858 putative methionine/glutamine aminotransferase
Query= BRENDA::Q9HUI9 (393 letters) >FitnessBrowser__Putida:PP_0858 Length = 382 Score = 171 bits (434), Expect = 2e-47 Identities = 120/360 (33%), Positives = 184/360 (51%), Gaps = 13/360 (3%) Query: 35 LLLSVGDPDFDTPAPIVQAAIDSLLAGNTHYADVRGKRALRQRIAERHRRRSGQAVDAEQ 94 L LS G PDF+ P ++ A + AG+ Y+ + G ALRQ++A + R G VDA+Q Sbjct: 27 LNLSQGFPDFNGPQALLDAVGRHVAAGHNQYSPMTGLPALRQQVAAKVERLYGARVDADQ 86 Query: 95 -VVVLAGAQCALYAVVQCLLNPGDEVIVAEPMYVTYEAVFGACGARVVPVPVRSENGFRV 153 V + GA A++ +Q +++ GDEVIV +P Y +YE G R V V + S+ FR+ Sbjct: 87 EVTITPGATEAIFCAIQAVVHAGDEVIVFDPCYDSYEPSVELAGGRCVHVQL-SDGDFRI 145 Query: 154 QAEEVAALITPRTRAMALNSPHNPSGASLPRATWEALAELCMAHDLWMISDEVYSELLFD 213 ++ + ++PRTR + LNSPHNPSGA + R + LA L D++++SDEVY L++D Sbjct: 146 DWQKFSDALSPRTRMVILNSPHNPSGALITREDLDQLAALIADRDIYLVSDEVYEHLVYD 205 Query: 214 G-EHVSPASLPGMADRTATLNSLSKSHAMTGWRVGWVVGPAALCAHLENLALCMLYGSPE 272 G H S + + R ++S K++ +TGW+ G+V+ P AL A L + + + Sbjct: 206 GVRHASVLAHEQLYSRAFVVSSFGKTYHVTGWKTGYVIAPPALSAELRKVHQYVNFCGVT 265 Query: 273 FIQDAACTALEAPLPELEAMREAYRRRRDLVIECLADSPGLRPLRPDGGMFVMVD---IR 329 +Q A + ++ + Y+ +RDL L D R G F +VD IR Sbjct: 266 PLQCALADFMAGHPEHIDELPAFYQAKRDLFCG-LLDGSRFNFTRTTGTYFQLVDYSQIR 324 Query: 330 PTGLSAQAFADRLLDRHGVSVLAGEAFGPSAAGH---IRLGLVLGAEPLREACRRIALCA 386 P L+ + L HGV+ + F +RL E LR+A R LCA Sbjct: 325 P-DLNDVDMSLWLTREHGVATIPVSVFYQQPIPEQRLVRLCFAKREETLRQAAER--LCA 381 Lambda K H 0.322 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 412 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 382 Length adjustment: 30 Effective length of query: 363 Effective length of database: 352 Effective search space: 127776 Effective search space used: 127776 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory