Align Arginine N-succinyltransferase; AST; AOST; EC 2.3.1.109 (characterized)
to candidate PP_4479 PP_4479 arginine N-succinyltransferase, subunit beta
Query= SwissProt::P0AE37 (344 letters) >FitnessBrowser__Putida:PP_4479 Length = 342 Score = 330 bits (845), Expect = 4e-95 Identities = 170/342 (49%), Positives = 230/342 (67%), Gaps = 3/342 (0%) Query: 2 MVIRPVERSDVSALMQLASKTGG-GLTSLPANEATLSARIERAIKTWQGELPKSEQGYVF 60 M++RPV SD+ AL++LA TG GLT+LPANE L R+ A K+++GE + + Y+F Sbjct: 1 MIVRPVRSSDLPALIELARSTGTTGLTTLPANEERLGHRVGWAEKSFRGEAERGDTDYLF 60 Query: 61 VLEDSETGTVAGICAIEVAVGLNDPWYNYRVGTLVHASKELNVYNALPTLFLSNDHTGSS 120 VLE+ E G V GI AI AVGL +PWYNYRVG V AS+EL +Y +PTLFL+ND TG+S Sbjct: 61 VLENDE-GLVVGISAIAGAVGLREPWYNYRVGLTVSASQELKIYREIPTLFLANDLTGNS 119 Query: 121 ELCTLFLDPDWRKEGNGYLLSKSRFMFMAAFRDKFNDKVVAEMRGVIDEHGYSPFWQSLG 180 ELC+LFL D+R NG LLS++R +F+A F + F K++AEMRG+ DE G SPFW+SLG Sbjct: 120 ELCSLFLRSDYRSGLNGRLLSRARMLFIAEFPELFGKKIIAEMRGMSDEQGRSPFWESLG 179 Query: 181 KRFFSMDFSRADFLCGTGQKAFIAELMPKHPIYTHFLSQEAQDVIGQVHPQTAPARAVLE 240 + FF M+FS+AD+L G G K+FIAELMPK P+YT FLS+ A+ VIG+VH T PA A+L+ Sbjct: 180 RHFFKMEFSQADYLTGVGNKSFIAELMPKFPLYTCFLSEAARSVIGRVHKDTEPALAMLK 239 Query: 241 KEGFRYRNYIDIFDGGPTLECDIDRVRAIRKSRLVEVAEGQPAQGDFPACLVANENYHHF 300 +EGF Y+ Y+DIFD GP +ECD ++RA+R+S+ + +A G P D ++ N Sbjct: 240 QEGFNYQGYVDIFDAGPAIECDTAKIRAVRESQTLVLAVGTPGD-DATPFIIHNRKRDDC 298 Query: 301 RVVLVRTDPATERLILTAAQLDALKCHAGDRVRLVRLCAEEK 342 R+ A L++ L+ GD VR V L A + Sbjct: 299 RITAAPARLAAGTLVVDPLTAKRLRMGVGDNVRAVPLSASRE 340 Lambda K H 0.321 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 339 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 342 Length adjustment: 29 Effective length of query: 315 Effective length of database: 313 Effective search space: 98595 Effective search space used: 98595 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
Align candidate PP_4479 PP_4479 (arginine N-succinyltransferase, subunit beta)
to HMM TIGR03244 (astA: arginine N-succinyltransferase (EC 2.3.1.109))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03244.hmm # target sequence database: /tmp/gapView.32168.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03244 [M=336] Accession: TIGR03244 Description: arg_catab_AstA: arginine N-succinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-161 522.1 0.0 2.8e-161 521.9 0.0 1.0 1 lcl|FitnessBrowser__Putida:PP_4479 PP_4479 arginine N-succinyltrans Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Putida:PP_4479 PP_4479 arginine N-succinyltransferase, subunit beta # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 521.9 0.0 2.8e-161 2.8e-161 1 336 [] 2 335 .. 2 335 .. 0.99 Alignments for each domain: == domain 1 score: 521.9 bits; conditional E-value: 2.8e-161 TIGR03244 1 ivrpvktsdldallelakeaGv.GltslpaneellekrieraeksfageleraeegylfvledtetgkvvGvsai 74 ivrpv++sdl+al+ela+++G+ Glt+lpanee+l +r+ +aeksf+ge+er++++ylfvle+ ++g vvG+sai lcl|FitnessBrowser__Putida:PP_4479 2 IVRPVRSSDLPALIELARSTGTtGLTTLPANEERLGHRVGWAEKSFRGEAERGDTDYLFVLEN-DEGLVVGISAI 75 79*******************88***************************************9.99********* PP TIGR03244 75 eaavGleepfynyrvgkvvhaskelniykkletlflsndltgaselCtlfldeeyrkelnGkllskarflflaef 149 + avGl+ep+ynyrvg +v+as+el+iy++++tlfl+ndltg+selC+lfl+++yr++lnG+lls+ar+lf+aef lcl|FitnessBrowser__Putida:PP_4479 76 AGAVGLREPWYNYRVGLTVSASQELKIYREIPTLFLANDLTGNSELCSLFLRSDYRSGLNGRLLSRARMLFIAEF 150 *************************************************************************** PP TIGR03244 150 kerfskkiiaemrGvsdeeGrsPfWealgkkffsldfskadylsgiGkkafiaelmPkfPiyvdllskeaqdvig 224 +e+f+kkiiaemrG+sde+GrsPfWe+lg++ff+++fs+adyl+g+G+k+fiaelmPkfP+y+++ls++a++vig lcl|FitnessBrowser__Putida:PP_4479 151 PELFGKKIIAEMRGMSDEQGRSPFWESLGRHFFKMEFSQADYLTGVGNKSFIAELMPKFPLYTCFLSEAARSVIG 225 *************************************************************************** PP TIGR03244 225 kvhektkPalalleseGlryqgyvdifdaGptleaevakiravresklvevavaesaaedeaepylvanekledf 299 +vh++t+Pala+l++eG++yqgyvdifdaGp++e+++akiravres+++++av+++ +++ +p++++n+k +d+ lcl|FitnessBrowser__Putida:PP_4479 226 RVHKDTEPALAMLKQEGFNYQGYVDIFDAGPAIECDTAKIRAVRESQTLVLAVGTPGDDA--TPFIIHNRKRDDC 298 ******************************************************998665..************* PP TIGR03244 300 rvvlvessldaeelvlsaeeakalkveeGdkvrvval 336 r+++++++l+a++lv+++ +ak+l++ Gd+vr v+l lcl|FitnessBrowser__Putida:PP_4479 299 RITAAPARLAAGTLVVDPLTAKRLRMGVGDNVRAVPL 335 **********************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (336 nodes) Target sequences: 1 (342 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.44 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory