Align gamma-glutamyl-gamma-aminobutyrate hydrolase (EC: 3.5.1.94) (characterized)
to candidate PP_3598 PP_3598 Peptidase C26
Query= reanno::SB2B:6936606 (267 letters) >FitnessBrowser__Putida:PP_3598 Length = 269 Score = 350 bits (898), Expect = e-101 Identities = 162/248 (65%), Positives = 195/248 (78%), Gaps = 1/248 (0%) Query: 12 RKPVILMSMGQQDRNGHAYQVMTHKYMQPVVDISDCIPLLIPTCFGVADIEQYLDMADGV 71 RKPV+LM+MG Q+R GH YQVMTHKY+ P+V+ SDC+P+L+PTC G D+E YLDMADGV Sbjct: 14 RKPVVLMTMGSQERKGHDYQVMTHKYITPLVEFSDCVPVLVPTCCGTEDLETYLDMADGV 73 Query: 72 YLSGAASNIDPSLYGQENLTPEKKQDLARDLVDIALIKGAVKRGLPILGICRGMQEMNIA 131 YL+GA SNIDP+LYGQEN TP K QD RDL DI L+K A+KRGLPI GICRGMQE+N+A Sbjct: 74 YLTGAGSNIDPALYGQENQTPGKGQDQNRDLFDIPLVKAAIKRGLPIFGICRGMQEINVA 133 Query: 132 FGGDLYQKVHDEDHLNDHREDPDTPPDVQYGASHSISMVKGSWLHKLLG-DTIEVNSLHG 190 GGD+YQKV+ E NDHRE+P+ P +VQY H + + GSWLH LG D I VNSLHG Sbjct: 134 LGGDIYQKVYAEPGFNDHRENPEDPVEVQYAQVHGVKIQPGSWLHDTLGTDEIRVNSLHG 193 Query: 191 QGIKTLGKGLEALALAEDGLVEALHAPYLPQFTLGVQWHPEWKALENPDSIKIFKAFGEA 250 QG+ LG G+EA+A AEDGLVEA+HAP + F VQWHPEW+A +NPDSIKIF+AFG+A Sbjct: 194 QGLHKLGAGIEAIARAEDGLVEAIHAPSISPFLFAVQWHPEWQAAKNPDSIKIFQAFGDA 253 Query: 251 CRRRAGSA 258 CR + A Sbjct: 254 CRAQVRKA 261 Lambda K H 0.318 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 290 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 269 Length adjustment: 25 Effective length of query: 242 Effective length of database: 244 Effective search space: 59048 Effective search space used: 59048 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory