GapMind for catabolism of small carbon sources

 

Aligments for a candidate for rocD in Pseudomonas putida KT2440

Align Ornithine aminotransferase; OAT; EC 2.6.1.13; Ornithine--oxo-acid aminotransferase (uncharacterized)
to candidate PP_0372 PP_0372 Acetylornithine aminotransferase 2

Query= curated2:Q89RB7
         (404 letters)



>lcl|FitnessBrowser__Putida:PP_0372 PP_0372 Acetylornithine
           aminotransferase 2
          Length = 426

 Score =  217 bits (552), Expect = 6e-61
 Identities = 136/372 (36%), Positives = 189/372 (50%), Gaps = 9/372 (2%)

Query: 26  VLSRGEGVWVWDTDGNRYLDCLSAYSAVSQGHCHPKILAAMVEQAHRLTLTSRAFHNDQL 85
           V  RG+G W+WD +G+ YLD     +  S GH    ++ A+  QA  L      FHN  L
Sbjct: 45  VFVRGQGSWLWDNEGHAYLDFTQGGAVNSLGHSPSVLVKALGNQAQALINPGSGFHNRGL 104

Query: 86  APFYEEIAALTGSHKVLPMNSGAEAVESAIKSVRKWGYEVKGVPDDQAEIIVCADNFHGR 145
                 +   TGS +   +NSGAEA E AIK  RKWG   +   +    II  +   HGR
Sbjct: 105 LGLVNRLCQSTGSDQAYLLNSGAEACEGAIKLARKWGQLHR---NGAYHIITASQACHGR 161

Query: 146 TLGIVGFSTDPETRGHFGPFAPGFRIIPFGDAAALEQAITPNTVAFLVEPIQGEAGVIIP 205
           +LG +  S DP       P  PGF  +PF D AAL   +   TVA ++EPIQGEAGVI  
Sbjct: 162 SLGALSAS-DPLPCNRCEPGLPGFSKVPFNDLAALHAEVDSRTVAIMLEPIQGEAGVIPA 220

Query: 206 PAGYFTKVRELCTANNVMLVLDEIQTGLGRTGKLLAEQHEGIEADVTLLGKALAGGFYPV 265
              Y   V  LC    ++L+LDE+QTG+GR G LLAE+  G+ AD+  LGK L GG  P+
Sbjct: 221 TQEYLKGVETLCRELGILLILDEVQTGIGRCGALLAEELYGVRADIITLGKGLGGG-VPL 279

Query: 266 SAVLSNNEVLGTLRPGQHGSTFGGNPLACAVARAAMRVLVEEGMIENAARQGARLLEGLK 325
           +A+L+  +      PG+   +  GN L CA   A +  ++E G +      G  L EGL 
Sbjct: 280 AALLARGKAC-CAEPGELEGSHHGNALMCAAGLAVLDSVLEPGFLAQVQDNGRHLREGLS 338

Query: 326 DIRANTVR-EVRGRGLMLAVELHPEAGRARRYCEALQGKGILAKDTHGHTIRIAPPLVIT 384
            +     + EVRG GL+ A++L  +   AR    A   +G+L        +R +P L ++
Sbjct: 339 RLTGRYGQGEVRGHGLLWALQL--KENLARELVAAALHEGLLLNAPQVDVVRFSPALTVS 396

Query: 385 SDEVDWALEQFA 396
              +D  L + A
Sbjct: 397 KGNIDEMLLRLA 408


Lambda     K      H
   0.319    0.136    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 511
Number of extensions: 29
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 404
Length of database: 426
Length adjustment: 31
Effective length of query: 373
Effective length of database: 395
Effective search space:   147335
Effective search space used:   147335
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory