Align arginase (EC 3.5.3.1) (characterized)
to candidate PP_2196 PP_2196 agmatinase
Query= metacyc::MONOMER-14988 (338 letters) >FitnessBrowser__Putida:PP_2196 Length = 311 Score = 100 bits (248), Expect = 6e-26 Identities = 78/271 (28%), Positives = 121/271 (44%), Gaps = 15/271 (5%) Query: 65 GIPLGHNSSFLQGPAFAPPLIREAIWCGSTNSTTEEGKILDDQRVLTDVGDLPVQELRDT 124 G+P +S G F P IR A + D + D GD P Sbjct: 39 GVPFDTATSNRPGARFGPRAIRAASVQQAWARHWPWAFDPFDHLAVIDYGDCPFDSGTPQ 98 Query: 125 GIDDDRLMSTVSESVKLVMDENPLRPLVLGGDHSISYPVVRAVSEKLGGPVDILHLDAHP 184 + D ++ + ++ L LGGDH ISYP+++A + + GP+ ++H DAH Sbjct: 99 SVPD-----SIEAHAEHILQAG-CAMLTLGGDHFISYPLLKAHARR-HGPLALIHFDAHS 151 Query: 185 DIYDAFEGNKYSHASSFARIMEGGYA--RRLLQVGIRSINLEGREQGKRFGVEQYEMRTF 242 D + G + H + F G +Q+G+R+ N + + F + Sbjct: 152 DTWPDEAGKRIDHGTMFWHAAREGLVDPAHSVQIGLRTTN----DDSQGFAILDARQVHR 207 Query: 243 SRDRQFLENLKLGEGVKGVYISVDVDCLDPAFAPGVSHFESGGLSFRDVLNILHNLQG-D 301 + ++ G + VY++ D+DCLDPA+APG GGLS L IL L+G + Sbjct: 208 QGTEAVIAAIRQRVGERPVYLTFDIDCLDPAYAPGTGTPVCGGLSTVQALEILGGLRGIN 267 Query: 302 IVGADVVEYNPQRDTADGMTAMVAAKLVREL 332 +VG D+VE P D AD +TA+ A L E+ Sbjct: 268 LVGMDLVEVAPAYDHAD-ITALAGATLAMEM 297 Lambda K H 0.317 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 263 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 311 Length adjustment: 28 Effective length of query: 310 Effective length of database: 283 Effective search space: 87730 Effective search space used: 87730 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory