GapMind for catabolism of small carbon sources

 

Aligments for a candidate for speB in Pseudomonas putida KT2440

Align Agmatinase; Agmatine ureohydrolase; AUH; EC 3.5.3.11 (characterized)
to candidate PP_2196 PP_2196 agmatinase

Query= SwissProt::Q7X3P1
         (306 letters)



>lcl|FitnessBrowser__Putida:PP_2196 PP_2196 agmatinase
          Length = 311

 Score =  329 bits (843), Expect = 6e-95
 Identities = 161/280 (57%), Positives = 207/280 (73%), Gaps = 6/280 (2%)

Query: 31  YSSD---ADWVITGVPFDMATSGRAGTRHGPGAIRQISTNLAWEGHRWPWHFDMRERLKV 87
           YS D    D V++GVPFD ATS R G R GP AIR  S   AW  H WPW FD  + L V
Sbjct: 26  YSRDLRGVDVVVSGVPFDTATSNRPGARFGPRAIRAASVQQAWARH-WPWAFDPFDHLAV 84

Query: 88  VDCGDLVFNFGDAQDMSDKLQAHTEKLLAAGKRCLTFGGDHFVTLPLLRAHAKHFGKMAL 147
           +D GD  F+ G  Q + D ++AH E +L AG   LT GGDHF++ PLL+AHA+  G +AL
Sbjct: 85  IDYGDCPFDSGTPQSVPDSIEAHAEHILQAGCAMLTLGGDHFISYPLLKAHARRHGPLAL 144

Query: 148 VHFDAHTDTYAN--GSKFDHGTMFYHAPNEGLIDPQHSVQIGIRTEHDTNNGFTVLDAAQ 205
           +HFDAH+DT+ +  G + DHGTMF+HA  EGL+DP HSVQIG+RT +D + GF +LDA Q
Sbjct: 145 IHFDAHSDTWPDEAGKRIDHGTMFWHAAREGLVDPAHSVQIGLRTTNDDSQGFAILDARQ 204

Query: 206 VNDRGVDDLVAQIKEIVGSLPVYLTFDIDCLDPAFAPGTGTPVVGGLTTDKALKMLRALQ 265
           V+ +G + ++A I++ VG  PVYLTFDIDCLDPA+APGTGTPV GGL+T +AL++L  L+
Sbjct: 205 VHRQGTEAVIAAIRQRVGERPVYLTFDIDCLDPAYAPGTGTPVCGGLSTVQALEILGGLR 264

Query: 266 PLNIVGMDLVEVSPAYDQSDITALAGATIALDMLYLQAAK 305
            +N+VGMDLVEV+PAYD +DITALAGAT+A++ML L AA+
Sbjct: 265 GINLVGMDLVEVAPAYDHADITALAGATLAMEMLCLYAAR 304


Lambda     K      H
   0.321    0.138    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 355
Number of extensions: 17
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 306
Length of database: 311
Length adjustment: 27
Effective length of query: 279
Effective length of database: 284
Effective search space:    79236
Effective search space used:    79236
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 48 (23.1 bits)

Align candidate PP_2196 PP_2196 (agmatinase)
to HMM TIGR01230 (speB: agmatinase (EC 3.5.3.11))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01230.hmm
# target sequence database:        /tmp/gapView.14545.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01230  [M=275]
Accession:   TIGR01230
Description: agmatinase: agmatinase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
    3.2e-78  249.1   0.0    4.1e-78  248.8   0.0    1.0  1  lcl|FitnessBrowser__Putida:PP_2196  PP_2196 agmatinase


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Putida:PP_2196  PP_2196 agmatinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  248.8   0.0   4.1e-78   4.1e-78      13     274 ..      33     299 ..      24     300 .. 0.94

  Alignments for each domain:
  == domain 1  score: 248.8 bits;  conditional E-value: 4.1e-78
                           TIGR01230  13 AevvivgiPydattsyrpGsrhgpeaireastnLeayseeldrdlal...lkvvDagdlplaaGdaremvekiee 84 
                                          +vv+ g+P+d++ts rpG+r+gp air as++ ++   + ++ ++    l v+D gd p+  G ++ + ++ie+
  lcl|FitnessBrowser__Putida:PP_2196  33 VDVVVSGVPFDTATSNRPGARFGPRAIRAASVQQAWAR-HWPWAFDPfdhLAVIDYGDCPFDSGTPQSVPDSIEA 106
                                         699******************************98865.56665554445************************* PP

                           TIGR01230  85 vveelleegkfvvaiGGeHsitlpvirAvkkkfeklavvqfDAHtDlr.....defegeklshacvmrrvlelgl 154
                                         ++e++l++g  ++++GG+H+i++p+++A+++++++la+++fDAH D+         +++++++ ++ ++++++  
  lcl|FitnessBrowser__Putida:PP_2196 107 HAEHILQAGCAMLTLGGDHFISYPLLKAHARRHGPLALIHFDAHSDTWpdeagKRIDHGTMFWHAAREGLVDPA- 180
                                         ***********************************************9877777799999999999*******9. PP

                           TIGR01230 155 nvlqigiRsgikeeadlarennikvlkreledeiaevlakvldkpvyvtiDiDvlDPafaPGvgtpepgGltske 229
                                         +++qig+R+  ++ +++a  ++ +v +   e +ia   ++v ++pvy+t+DiD+lDPa+aPG+gtp+ gGl++ +
  lcl|FitnessBrowser__Putida:PP_2196 181 HSVQIGLRTTNDDSQGFAILDARQVHRQGTEAVIAAIRQRVGERPVYLTFDIDCLDPAYAPGTGTPVCGGLSTVQ 255
                                         99************************************************************************* PP

                           TIGR01230 230 llklfvlaekekkvvGlDvvEvaPvydssevtaltaaklalelll 274
                                         +l+  + +    ++vG+D+vEvaP+yd++++tal+ a+la+e+l 
  lcl|FitnessBrowser__Putida:PP_2196 256 ALE-ILGGLRGINLVGMDLVEVAPAYDHADITALAGATLAMEMLC 299
                                         ***.67788999*******************************95 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (275 nodes)
Target sequences:                          1  (311 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 8.16
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory