Align ABC transporter for D-Cellobiose and D-Salicin, periplasmic substrate-binding protein (characterized)
to candidate PP_1015 PP_1015 mannose/glucose ABC transporter, glucose-binding periplasmic protein
Query= reanno::Smeli:SMc04259 (411 letters) >FitnessBrowser__Putida:PP_1015 Length = 428 Score = 222 bits (565), Expect = 2e-62 Identities = 146/430 (33%), Positives = 209/430 (48%), Gaps = 34/430 (7%) Query: 6 LAAALGATAALPFGAASAT---DLEVTHWWTSGGEAAAVAELAKAFDATGNKWVDGAIAG 62 LAAA+ + +P GA +A +EV HWWTSGGE AAV L + G W DGA+AG Sbjct: 7 LAAAISFASLIPLGAQAADAKGSVEVVHWWTSGGEKAAVDVLKAQVEKDGFIWKDGAVAG 66 Query: 63 SGG-TARPIMISRITGGDPMAATQFNHGRQAEELVQAGLMRD--LTDIATKENWKEIVKP 119 GG TA ++ SR G+P Q G ++ GL+ L D+A + W ++ Sbjct: 67 GGGATAMTVLKSRAVAGNPPGVAQIK-GPDIQDWAATGLLDADVLKDVAKEGKWDSLLD- 124 Query: 120 SSLLDSCTIEGKIYCAPVNIHSWQWLWLSNAAFKQAGVE-VPKNWDEFVAAAPALEKAGI 178 + D+ +G PVNIH WLW++ FK+AG++ P DEF AAA L+ AG Sbjct: 125 KKVADTVKYDGDYVAVPVNIHRINWLWINPEVFKKAGIDKAPTTLDEFYAAADKLKAAGF 184 Query: 179 VPLAVGGQPWQANGAFDVLMVAIAGKENFEKVFAQKDEEVAAGPEIAKVF-KAADDARRM 237 +PLA GGQPWQ + F+ +++++ G + ++K D GP++ K + A M Sbjct: 185 IPLAHGGQPWQDSTVFESVVLSVMGVDGYKKALVDLDSATLTGPQMVKALTELKKVATYM 244 Query: 238 SKGTNVQDWNQATNMVITGKAGGQIMGDWAQGEFQLAGQKAGVDYTCLPGLGVNEVISTG 297 QDWN VI GKAG QIMGDWA+ E+ LA + AG DY C+P G ++ Sbjct: 245 DPDGKGQDWNLEAAKVINGKAGMQIMGDWAKSEWTLAKKTAGKDYQCVPFPGTDKSFLYN 304 Query: 298 GDAFYFPLLEDEEKSKAQEVLASTLLKPETQVAFNLKKGSLPVRGDVDLAAANDCMKKGL 357 D+ + S Q+ +A +L + Q F++ KGS+PVR D+ D K G Sbjct: 305 IDSLVVFKQNNAGTSAGQQDIARKVLGEDFQKVFSINKGSIPVRNDM----LADMGKYGF 360 Query: 358 DILAKGNVIQGTDQLLSADS-----------------QKQKEDLFSEFFANHSMTPEDAQ 400 D A+ D L A + Q D+ + + + P DA Sbjct: 361 DACAQ---TSAKDFLADAKTGGLQPSMAHNMATTLAVQGAFFDVVTNYINDPKADPADAA 417 Query: 401 KRFADIIAAA 410 K+ A I AA Sbjct: 418 KKLAAAIKAA 427 Lambda K H 0.315 0.131 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 508 Number of extensions: 28 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 411 Length of database: 428 Length adjustment: 32 Effective length of query: 379 Effective length of database: 396 Effective search space: 150084 Effective search space used: 150084 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory