Align TM0028, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate PP_0879 PP_0879 dipeptide ABC transporter - putative ATP binding subunit
Query= TCDB::Q9WXN5 (330 letters) >FitnessBrowser__Putida:PP_0879 Length = 322 Score = 166 bits (419), Expect = 9e-46 Identities = 98/294 (33%), Positives = 160/294 (54%), Gaps = 11/294 (3%) Query: 21 SVKAVDGLSFEILEDEVIGVVGESGCGKTTLSNVIFMNMVKPLTLVDGKIFLRVNGEFVE 80 +V VDGL ++ E++ +VGESG GK+ ++ + M ++ + + ++ Sbjct: 18 AVPVVDGLDLKVDAGEILAIVGESGSGKS-VTMMALMGLIDAPGRITADSLTFDGTDMLK 76 Query: 81 LSSMTRDEVKRKFWGKEITIIPQAAMNALMPTIRMEKYVRHLAESH-GIDEEELLDKARR 139 LS R RK GK+I ++ Q M AL P+ + + + H G+ + +A Sbjct: 77 LSGRQR----RKVVGKDIAMVFQDPMTALNPSYTVGFQIEEVLRQHLGLKGKAARQRALE 132 Query: 140 RFEEVGLDPLW--IKRYPFELSGGMRQRAVIAIATILNPSLLIADEPTSALDVVNQKVLL 197 ++V + + YP +LSGGM QR IA+A P LLIADEPT+ALDV Q ++ Sbjct: 133 LLKKVEIPAAESRLDAYPHQLSGGMSQRVAIAMAIAGEPKLLIADEPTTALDVTIQAQIM 192 Query: 198 KVLMQMKRQGIVKSIIFITHDIATVRQIADRMIIMYAGKIVEFAPVESLLEKPLHPYTQG 257 ++L+ ++++ + ++I ITHD+A V + A R+ +MYAG+ VE V L + P HPY++ Sbjct: 193 ELLVNLQKERNM-ALILITHDLAVVAETARRVCVMYAGQAVEVGQVPELFDVPAHPYSEA 251 Query: 258 LFNSVLTPEPEVKKRGITTIPGAPPNLINPPSGCRFHPRCPHAMDVCKEKEPPL 311 L ++ PE + + T+PG P + P GC PRCP+ D C+ + PPL Sbjct: 252 LLAAI--PEHSIGAERLATLPGIVPGRYDRPVGCLLSPRCPYVQDNCRRQRPPL 303 Lambda K H 0.321 0.138 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 290 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 322 Length adjustment: 28 Effective length of query: 302 Effective length of database: 294 Effective search space: 88788 Effective search space used: 88788 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory