Align CbtD, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate PP_0878 PP_0878 dipeptide ABC transporter, binding subunit
Query= TCDB::Q97VF5 (362 letters) >FitnessBrowser__Putida:PP_0878 Length = 322 Score = 171 bits (434), Expect = 2e-47 Identities = 101/299 (33%), Positives = 168/299 (56%), Gaps = 13/299 (4%) Query: 62 IIKAVNDVSFGVEKGEILGIIGESGSGKTTLISAILRAIRPPGKIISGKVIFNGMDIFSM 121 +++A+N VSF +E G+ L ++GESG GK+TL A+ P SG + G ++ Sbjct: 26 LVRALNGVSFELEAGKTLAVVGESGCGKSTLARALTLIEEPS----SGSLQIAGTEVKGA 81 Query: 122 TIDEFRKLLWKDISYVPQASQNALNPVLPISEIFYHEAISHGEADKKRVIERASELLKLV 181 + E RK L +D+ V Q+ +LNP I + + + K ++ ++++ V Sbjct: 82 SKAE-RKQLRRDVQMVFQSPYASLNPRQKIGDQLAEPLLINTSLSKAERRDKVQKMMEQV 140 Query: 182 GLDPARVLKMYPFQLSGGMKQRVMIALSLLLNPKLILMDEPTSALDMLNQELLLKLIKNI 241 GL P + YP SGG +QR+ +A +++L PK+++ DEPTSALD+ Q +L L ++ Sbjct: 141 GLRPEHYQR-YPHMFSGGQRQRIALARAMMLQPKVLVADEPTSALDVSIQAQVLNLFMDL 199 Query: 242 NQEMGVTIVYVTHDILNIAQIANRLLVMYKGYVMEEGKTEEIIKSPLNPYTSLLVSSIPS 301 +E V+++H++ + +A+++LVMY G E G E+I PL+PYT L+S+ P+ Sbjct: 200 QKEFNTAYVFISHNLAVVRHVADQVLVMYLGRPAEMGPKEDIYAKPLHPYTQALLSATPA 259 Query: 302 -----LKGEVKVINVPLDEPLVSKEKGCPFLARCSKAFGRCKEELPEIRLVYDRKVRCH 355 LK +++++ L PL + GC F RC A RC +E+P +R V R+V CH Sbjct: 260 IHPDPLKPKIRIVG-ELPNPL-NPPDGCAFHKRCPYATERCAKEVPALRQVSTRQVACH 316 Lambda K H 0.319 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 322 Length adjustment: 29 Effective length of query: 333 Effective length of database: 293 Effective search space: 97569 Effective search space used: 97569 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory