Align CbtF, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate PP_4453 PP_4453 glutathione ABC transporter ATP-binding subunit
Query= TCDB::Q97VF4 (324 letters) >FitnessBrowser__Putida:PP_4453 Length = 610 Score = 165 bits (417), Expect = 3e-45 Identities = 105/293 (35%), Positives = 165/293 (56%), Gaps = 21/293 (7%) Query: 3 LMELKGVSVIFEDKVGLFKK--RKFYALKDVSLSMNQGDLLIVLGESGAGKTTLGRVIVG 60 L+E+ G++ F+ + G FK+ + +A+++VS +++QG+ L ++GESG GK+T GR+I G Sbjct: 308 LLEVSGLTTRFDVRSGFFKRVTGRVHAVENVSFNLSQGETLAIVGESGCGKSTTGRLITG 367 Query: 61 LQKPTSGEVVYDGYNIWKNKRKIFKKYRKDVQLIPQDPYSTLPFNKTVEEILVAPILRWE 120 L PT G V +G + ++ RK +Q++ QDPYS+L +TV + ++ P+ Sbjct: 368 LLDPTHGSVKLEGVEL--GSITPMERARK-IQMVFQDPYSSLNPRQTVAQSIIEPLRVHG 424 Query: 121 KINKDELRKRLINLLELVKLTPAEEFLGKYPHQLSGGQKQRLSIARSLSVNPRIIVADEP 180 + + I LL V L PA+ + PH+ SGGQ+QR+ IAR+L++ P IVADE Sbjct: 425 LYDAKRCEEVAIELLVKVGL-PADA-AWRLPHEFSGGQRQRVCIARALALRPGTIVADEA 482 Query: 181 VTMVDASLRIGILNTLAEIKNRLNLTMVFITHDIPIARYFYHLFDKGNTIVMFAGRIVER 240 V+ +D S+++ I+N L E++ L L +FI+HD+ + H VM+ G IVE Sbjct: 483 VSALDVSVKVQIVNLLLELQQELGLGFIFISHDMAVVERVSH-----RVAVMYMGEIVEI 537 Query: 241 ADLEEILKDPLHPYTNDLIKLTPSIDNLYKEINVKINYERVEKGCPYRLRCPF 293 I DP HPYT LI P D K++ +RV G LR P+ Sbjct: 538 GPRAAIFNDPKHPYTRRLIDAVPIPDPARKQV------QRVSAG---TLRTPY 581 Score = 132 bits (333), Expect = 2e-35 Identities = 85/312 (27%), Positives = 157/312 (50%), Gaps = 16/312 (5%) Query: 3 LMELKGVSVIFEDKVGLFKKRKFYALKDVSLSMNQGDLLIVLGESGAGKTTLGRVIVGL- 61 ++E+ G++V F G +KD+S + +G+ L ++GESG+GK+ I+GL Sbjct: 12 VLEVTGLNVAFRRGGGWSP-----VVKDLSFRVARGETLAIVGESGSGKSVSAMSILGLL 66 Query: 62 ---QKPTSGEVVYDGYNIWKNKRKIFKKYRKD-VQLIPQDPYSTLPFNKTVEEILVAPIL 117 +G + G + R + + +I Q+P ++L T+ E + P+ Sbjct: 67 PANTSQVTGSIRLQGQELLCLPEPEMADIRGNRIAMIFQEPMTSLNPVMTIGEQIAEPLR 126 Query: 118 RWEKINKDELRKRLINLLELVKLTPAEEFLGKYPHQLSGGQKQRLSIARSLSVNPRIIVA 177 ++ + ++ + L+E V++ A+E YPHQ SGG +QR+ IA +L+ NP +++A Sbjct: 127 LHRGLDATQAKEEALKLMERVRIPAAQERYDDYPHQFSGGMRQRVMIAMALACNPAVLIA 186 Query: 178 DEPVTMVDASLRIGILNTLAEIKNRLNLTMVFITHDIPIARYFYHLFDKGNTIVMFAGRI 237 DEP T +D +++ IL + E++ + ++ +VFITHD+ + T+VM+ G + Sbjct: 187 DEPTTALDVTIQAQILELIKELQAQEHMAVVFITHDMGVVAQI-----ADRTLVMYRGDL 241 Query: 238 VERADLEEILKDPLHPYTNDLIKLTPSIDNLYKEINVKINYERVEKGCPYRLRCPFAMDI 297 VE A EI P PYT L+ P + ++ E + K + + + P D Sbjct: 242 VETASTSEIFSAPQKPYTKALLSAVPELGSMAAEPSPK-PFPIYDMAAGSNVPAPEMKDS 300 Query: 298 CKNEEPKLFKYS 309 ++ +P L + S Sbjct: 301 VRHTKPYLLEVS 312 Lambda K H 0.321 0.141 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 508 Number of extensions: 21 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 324 Length of database: 610 Length adjustment: 32 Effective length of query: 292 Effective length of database: 578 Effective search space: 168776 Effective search space used: 168776 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory