Align Citrate:H+ symporter (characterized)
to candidate PP_3666 PP_3666 Metabolite MFS transporter, MHS family
Query= TCDB::P16482 (444 letters) >FitnessBrowser__Putida:PP_3666 Length = 444 Score = 268 bits (685), Expect = 3e-76 Identities = 155/415 (37%), Positives = 234/415 (56%), Gaps = 13/415 (3%) Query: 36 GNFLEQFDFFLFGFYATYIAHTFFPASSEFASLMMTFAVFGAGFLMRPIGAIVLGAYIDK 95 GNF+E FD+ +G+ AT IA TFFP + + L+ TFAVF FL+RP+G IV G + D+ Sbjct: 33 GNFVEWFDYAAYGYLATIIAATFFPQTDKTTGLLATFAVFALSFLVRPLGGIVWGHFGDR 92 Query: 96 VGRRKGLIVTLSIMATGTFLIVLIPSYQTIGLWAPLLVLIGRLLQGFSAGAELGGVSVYL 155 GRR L ++ IM+ TF I L+P Y IGLWAP L+L+ RL+QGFSA E G + +L Sbjct: 93 HGRRNALSWSILIMSVSTFCIGLLPGYAQIGLWAPALLLLIRLVQGFSASGEYAGAAAFL 152 Query: 156 AEIATPGRKGFYTSWQSGSQQVAIMVAAAMGFALNAVLEPSAISDWGWRIPFLFGVLIVP 215 AE A PGR+G YTS S ++ AA L+ +L A+ +WGWR+PFL L P Sbjct: 153 AEYAPPGRRGLYTSIVPASTAAGLLFGAAFVAVLHELLSSEALHEWGWRLPFL---LAAP 209 Query: 216 FIFI---LRRKLEETQEFTARRHHLAMRQVFAT-----LLANWQVVIA-GMMMVAMTTTA 266 F + +R L++T +F L + AT LL + +A GM + + A Sbjct: 210 FGLVGRYIRMSLQDTPKFLEMEQRLETKAGMATTPLRELLGQHRRSLAIGMGVTCLNAVA 269 Query: 267 FYLITVYAPTFGKKVLMLSASDSLLVTLLVAISNFFWLPVGGALSDRFGRRSVLIAMTLL 326 FYL+ Y PT+ + +S DS + + + + + + G LSD+FGR+++L+ +LL Sbjct: 270 FYLLLSYMPTYLSSEMGMSERDSFIASTVSLATYIGLIFLMGRLSDQFGRKTMLVVASLL 329 Query: 327 ALATAWPALTMLANAPSFLMMLSVLLWLSFIYGMYNGAMIPALTEIMPAEVRVAGFSLAY 386 L P +L P L++L++ + + M +G + L EI P VR +GF+L++ Sbjct: 330 FLGLTVPLFRLLDGQP-LLVILAIQILFGAMLAMNDGTLPCLLAEIFPTRVRFSGFALSF 388 Query: 387 SLATAVFGGFTPVISTALIEYTGDKASPGYWMSFAAICGLLATCYLYRRSAVALQ 441 ++A A+FGG P I+T LI+ TG K +P ++ AA+ L+A + AL+ Sbjct: 389 NVANALFGGTAPFIATWLIQVTGSKLAPAGYLLAAALVALVAMLMCRETAHAALE 443 Lambda K H 0.329 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 541 Number of extensions: 30 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 444 Length of database: 444 Length adjustment: 32 Effective length of query: 412 Effective length of database: 412 Effective search space: 169744 Effective search space used: 169744 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory