Align Citrate:H+ symporter (characterized)
to candidate PP_4461 PP_4461 Major facilitator family transporter
Query= TCDB::P16482 (444 letters) >FitnessBrowser__Putida:PP_4461 Length = 430 Score = 254 bits (649), Expect = 4e-72 Identities = 147/400 (36%), Positives = 227/400 (56%), Gaps = 6/400 (1%) Query: 29 AILRVTSGNFLEQFDFFLFGFYATYIAHTFFPASSEFASLMMTFAVFGAGFLMRPIGAIV 88 A+ SGN LE +DF ++ F+AT IA FFP E SL+ TFA +GAGF+ RP+G+ V Sbjct: 13 AVATSGSGNLLEVYDFAVYAFFATTIAKLFFPNVDETTSLLQTFAAYGAGFIARPLGSYV 72 Query: 89 LGAYIDKVGRRKGLIVTLSIMATGTFLIVLIPSYQTIGLWAPLLVLIGRLLQGFSAGAEL 148 +G DK GR+ +++T+ MA G+ I LIP+Y+TIG+ AP+L+++ R LQGF+AG E Sbjct: 73 IGRIGDKRGRKPAMLLTIICMAIGSIGIGLIPTYETIGVGAPILLVMLRCLQGFAAGGEW 132 Query: 149 GGVSVYLAEIATPGRKGFYTSWQSGSQQVAIMVAAAMGFALNAVLEPSAISDWGWRIPFL 208 G + Y+ E + GRKGF+ S+QS S ++A+ + AL ++ + DWGWR+PF+ Sbjct: 133 GTSASYIVEWSPAGRKGFFGSFQSVSSSGGALLASLVASAL-LLIPAEDLLDWGWRVPFI 191 Query: 209 FGVL-IVPFIFILRRKLEETQEFTARRHHLAMRQVFATLLANWQVVIAGMMMVAMTTTAF 267 G L I F LR EET E+ + + V T + + + TT Sbjct: 192 AGGLAIFAFSLFLRAHAEETPEYVNSKAEV----VNPTDSKPYVLGLQAFGFTIFWTTLS 247 Query: 268 YLITVYAPTFGKKVLMLSASDSLLVTLLVAISNFFWLPVGGALSDRFGRRSVLIAMTLLA 327 YL++ Y T+ + L+ +++L+ + + + +PV GALSDRFGR+ +L+ L Sbjct: 248 YLVSAYMVTYTQNHAGLTRTEALISSNIALLLQITLIPVAGALSDRFGRKPLLLLACLGT 307 Query: 328 LATAWPALTMLANAPSFLMMLSVLLWLSFIYGMYNGAMIPALTEIMPAEVRVAGFSLAYS 387 A+P L +++ SF ++ + LS ++ MY+G + EI P +R ++ Y+ Sbjct: 308 ATLAYPILNLMSGGASFHQVVMLQCCLSALFAMYSGPGPATICEIFPTRLRNTWMTVGYT 367 Query: 388 LATAVFGGFTPVISTALIEYTGDKASPGYWMSFAAICGLL 427 LA FGGF P+IST LI T ASP + + AA+ L Sbjct: 368 LAVCCFGGFAPLISTWLISVTKIAASPAFLLIPAAVVSAL 407 Lambda K H 0.329 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 513 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 444 Length of database: 430 Length adjustment: 32 Effective length of query: 412 Effective length of database: 398 Effective search space: 163976 Effective search space used: 163976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory