Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate PP_4425 PP_4425 putative amino-acid ABC transporter ATP-binding protein y4tH
Query= reanno::pseudo3_N2E3:AO353_03040 (254 letters) >FitnessBrowser__Putida:PP_4425 Length = 255 Score = 242 bits (617), Expect = 6e-69 Identities = 125/241 (51%), Positives = 169/241 (70%), Gaps = 1/241 (0%) Query: 11 KRYGSHEVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKILLNNEELKLV 70 KRYG+ VL G+ L +AG+ ++IIG SGSGKST LR + LE G IL+ E L + Sbjct: 9 KRYGNFTVLDGLELDVSAGEKVAIIGPSGSGKSTLLRVLMTLEGIDEGSILVEGESLTHM 68 Query: 71 ANKDGALKAADPKQLQRMRSRLSMVFQHFNLWSHMTAMENIMEAPVHVLGMSKAEAREKA 130 ++G L AD K ++ +R ++ MVFQ FNL+ H TA++N+ EAPVHVLG+ AEAR++A Sbjct: 69 QGRNGKLVPADAKHVRAVRGKIGMVFQGFNLFPHRTALQNVTEAPVHVLGVKPAEARDRA 128 Query: 131 ELYLAKVGVSHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSALDPELVGDVLK 190 L VG+ + D YP +SGG+QQRVAIARALAM P+VMLFDE TSALDPEL G+VL Sbjct: 129 VQLLEMVGLGAKLDHYPSQLSGGQQQRVAIARALAMRPKVMLFDEVTSALDPELCGEVLN 188 Query: 191 VMQALAQEGR-TMVVVTHEMGFAREVSNQLVFLHKGVVEESGNPREVLVNPQSERLQQFL 249 V++ L E + TM++VTH+MGFARE ++++ F +KG + E G P ++ PQ ER + FL Sbjct: 189 VIRRLGSEHKLTMLMVTHQMGFAREFADRVCFFYKGRIHEQGAPGQLFETPQEERTRSFL 248 Query: 250 S 250 S Sbjct: 249 S 249 Lambda K H 0.317 0.131 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 255 Length adjustment: 24 Effective length of query: 230 Effective length of database: 231 Effective search space: 53130 Effective search space used: 53130 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory