Align ABC transporter for L-Arginine and L-Citrulline, permease component 2 (characterized)
to candidate PP_3594 PP_3594 Amino acid ABC transporter, membrane protein
Query= reanno::pseudo3_N2E3:AO353_03050 (229 letters) >FitnessBrowser__Putida:PP_3594 Length = 239 Score = 150 bits (378), Expect = 3e-41 Identities = 77/216 (35%), Positives = 124/216 (57%) Query: 4 GYGAVILDGAWLTLQLALSSMALAIVLGLIGVALRLSPIRWLARLGDLYSTVIRGIPDLV 63 G+G +L GA +T+ LAL+ + + + LGL+ S R +STV RG+P+L+ Sbjct: 14 GWGQALLAGALVTVSLALACLPIGLPLGLVVALAARSRKRLPRAWATTFSTVFRGLPELL 73 Query: 64 LILLIFYGGQDLLNRVAPLLGYDDYIDLNPLVAGIGTLGFIFGAYLSETFRGAFMAIPKG 123 +L+I+YG Q ++ +GY +N +A + +F A+ SE + AF +PKG Sbjct: 74 TLLIIYYGCQIAAQKILAAMGYQGEFLINTFLAAMIAFSLVFAAFSSEIWLAAFKTLPKG 133 Query: 124 QAEAGAAYGMSSFQVFFRVLVPQMIRLAIPGFTNNWLVLTKATALISVVGLQDMMFKAKQ 183 Q EA +A G+S FF+VL+PQ+ R+A+PG +NNWL L K T+L+S + L D+M + Sbjct: 134 QLEACSALGLSKRTGFFKVLLPQLTRIALPGLSNNWLSLLKDTSLVSTISLVDLMRQTNL 193 Query: 184 AADATREPFTFFLAVAAMYLVITSVSLLALRHLEKR 219 A T+EP F+ YL+ ++S ++E+R Sbjct: 194 AVSVTKEPMFFYGVACLGYLLFAALSGRVFAYIERR 229 Lambda K H 0.329 0.144 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 229 Length of database: 239 Length adjustment: 23 Effective length of query: 206 Effective length of database: 216 Effective search space: 44496 Effective search space used: 44496 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory