Align ABC transporter for L-Arginine and L-Citrulline, permease component 1 (characterized)
to candidate PP_4750 PP_4750 Amino acid ABC transporter, permease protein
Query= reanno::pseudo1_N1B4:Pf1N1B4_3432 (229 letters) >FitnessBrowser__Putida:PP_4750 Length = 213 Score = 115 bits (287), Expect = 9e-31 Identities = 67/199 (33%), Positives = 113/199 (56%), Gaps = 12/199 (6%) Query: 8 VILDGVWLTLQLALSSMVLAIVLGLIGVALRLSPIRWLAWLGDLYSTVIRGIPDLVLILL 67 ++L+G+ T+ + + + + +VLG ALR+S ++ L+ L + +R IP +V + Sbjct: 7 MLLNGIPWTIAVTVLAFCVGVVLGFPICALRMSRVKVLSILAAMLVLTLRSIPPIVWLFF 66 Query: 68 IFYGGQDLLNRVAPMFGYDDYIDLNPLAAGIGTLGFIFGAYLSETFRGAFMAIPKGQAEA 127 IF+G G YI L+P A + LG I A++SE +RGAF AIP GQ EA Sbjct: 67 IFFG-----------IG-GGYISLSPFTAAVVGLGLITAAHMSEVYRGAFAAIPAGQFEA 114 Query: 128 GMAYGMSSFQVFFRVLVPQMIRLAIPGFTNNWLVLTKATALISVVGLQDMMFKAKQAADA 187 +S+ Q FF V++PQ++R+AIP + L K +A+ S +G+ ++ F+A Q + Sbjct: 115 AYVLNLSAPQRFFDVVLPQLVRIAIPTSATYAIGLLKDSAVASTIGVGEISFQAYQVSQQ 174 Query: 188 TREPFTFFLAVAAMYLVIT 206 T + + + A A +YLV++ Sbjct: 175 TFQGLSVYTAAAVVYLVLS 193 Lambda K H 0.329 0.144 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 174 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 229 Length of database: 213 Length adjustment: 22 Effective length of query: 207 Effective length of database: 191 Effective search space: 39537 Effective search space used: 39537 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory