Align ABC transporter substrate-binding protein; SubName: Full=Histidine transport system substrate-binding protein (characterized, see rationale)
to candidate PP_0282 PP_0282 L-arginine ABC transporter - periplasmic binding subunit
Query= uniprot:A0A1N7UK26 (258 letters) >FitnessBrowser__Putida:PP_0282 Length = 250 Score = 167 bits (423), Expect = 2e-46 Identities = 95/246 (38%), Positives = 151/246 (61%), Gaps = 11/246 (4%) Query: 7 LFAALLLPLCATAHAQEWKEIRFGVFPEYPPFESVAADGSLQGFDIELGNAICAKLEVKC 66 L AA L + A A A E ++R G+ YPPF + A G++ GFD ++G+A+CAK++V+C Sbjct: 9 LAAAATLVMSANAMAAE--KLRMGIEAAYPPFNNKDASGNVVGFDKDIGDALCAKMKVEC 66 Query: 67 TWVHNEFDGMIPALRARKFDAIMSSMAVTPAREKIIDFSDRLFLSPTSVITRKSADFGDT 126 + V +++DG+IPAL A+KFD ++SS+++T R++ +DF++ + + I K+ DF Sbjct: 67 SVVTSDWDGIIPALNAKKFDFLVSSLSITDERKQAVDFTNPYYSNKLQFIAPKNVDFKTD 126 Query: 127 PESLMGKQVGVLQGSLQEAYARAHLAKLGAQIKAYQSQDQNYADLQNGRLDATLTDKLEA 186 ESL GK +G + +L Y + + +IK Y +Q+ Y DL +GR+D L DK Sbjct: 127 KESLKGKVIGTQRATLAGTYLEDNYPDV--EIKLYDTQENAYLDLVSGRIDGILADKY-V 183 Query: 187 QLNFLSKPEGSDFKTGPAFK-DPTLPLD-IAMGLRKNDQALRALINKGIAAVQADGTYAQ 244 Q +L +GS+F+ FK +P + D I + +RK D LR +NK +A ++ADGTY + Sbjct: 184 QYEWLKSKDGSNFE----FKGEPVMDSDKIGIAVRKGDTKLRDDLNKALAEIKADGTYKK 239 Query: 245 IQKKYF 250 I KYF Sbjct: 240 INDKYF 245 Lambda K H 0.319 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 250 Length adjustment: 24 Effective length of query: 234 Effective length of database: 226 Effective search space: 52884 Effective search space used: 52884 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory