Align putrescine-2-oxoglutarate transaminase (EC 2.6.1.82) (characterized)
to candidate PP_4223 PP_4223 diaminobutyrate-2-oxoglutarate transaminase
Query= BRENDA::P42588 (459 letters) >FitnessBrowser__Putida:PP_4223 Length = 452 Score = 204 bits (520), Expect = 4e-57 Identities = 139/417 (33%), Positives = 216/417 (51%), Gaps = 47/417 (11%) Query: 78 DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQ-PLHSQELLDPLRAMLAKTLAAL 136 D +G++FIDCL G G +GH +PVVV A+Q LA + PLH+ +L P++ + L + Sbjct: 45 DVEGRQFIDCLAGAGTLALGHNHPVVVEAIQRVLADELPLHTLDLTTPVKDRFVQDLFGI 104 Query: 137 TPGKL----KYSFFCNSGTESVEAALKLAKAYQSPRGKFTFIATSGAFHGKSLGALSATA 192 P L K F +GT++VEAALKL + + G+ T +A GA+HG S GAL+ Sbjct: 105 LPEALRREAKVQFCGPTGTDAVEAALKLVR---TATGRSTVLAFQGAYHGMSQGALNLMG 161 Query: 193 KSTFRKP----------FMPLLPGFRHVPFG---------NIEAMRTALNECKKTGDDVA 233 ++P FMP +R PFG N+ + L + + A Sbjct: 162 SHGPKQPLGALLGNGVQFMPYPYDYR-CPFGLGGEAGVKANLHYLENLLLDPESGVPLPA 220 Query: 234 AVILEPIQGEGGVILPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQP 293 AVILE +QGEGGV+ +L VR++ ++ G +I+DE+Q+G RTG+MFA EH + P Sbjct: 221 AVILEVVQGEGGVVPADIEWLKGVRRITEQAGVALIVDEIQSGFARTGRMFAFEHAGIVP 280 Query: 294 DILCLAKALGGGVMPIGATIATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQ 353 D++ L+KA+GG +P+ + + + + P H TF GN +A AA A IN L+E Sbjct: 281 DVVTLSKAIGGS-LPLAVVVYRDWLDTW---KPGAHAGTFRGNQMAMAAGSAVINYLVEH 336 Query: 354 NLPAQAEQKGDMLLDGFRQLAREYPDLVQEARGKGMLMAIEFVD--------------NE 399 L AE G L ++L R+YP L + RG+G+++ +E VD + Sbjct: 337 RLAEHAEAMGQRLRGHLQRLQRDYPQL-GDIRGRGLMLGVELVDPQGQPDALGHPPANRD 395 Query: 400 IGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLTLTIEQCELVIKAARKALAAMRVSV 456 + E ++ +++ + +R PPL ++ EQ + V + A+AA SV Sbjct: 396 LAPKVQRECLKRGLILELGGRHGAVVRFLPPLIISAEQIDEVAQRFSAAVAAAVGSV 452 Lambda K H 0.320 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 499 Number of extensions: 31 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 452 Length adjustment: 33 Effective length of query: 426 Effective length of database: 419 Effective search space: 178494 Effective search space used: 178494 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory