GapMind for catabolism of small carbon sources

 

Aligments for a candidate for puuD in Pseudomonas putida KT2440

Align gamma-glutamyl-gamma-aminobutyrate hydrolase (EC: 3.5.1.94) (characterized)
to candidate PP_3598 PP_3598 Peptidase C26

Query= reanno::SB2B:6936606
         (267 letters)



>lcl|FitnessBrowser__Putida:PP_3598 PP_3598 Peptidase C26
          Length = 269

 Score =  350 bits (898), Expect = e-101
 Identities = 162/248 (65%), Positives = 195/248 (78%), Gaps = 1/248 (0%)

Query: 12  RKPVILMSMGQQDRNGHAYQVMTHKYMQPVVDISDCIPLLIPTCFGVADIEQYLDMADGV 71
           RKPV+LM+MG Q+R GH YQVMTHKY+ P+V+ SDC+P+L+PTC G  D+E YLDMADGV
Sbjct: 14  RKPVVLMTMGSQERKGHDYQVMTHKYITPLVEFSDCVPVLVPTCCGTEDLETYLDMADGV 73

Query: 72  YLSGAASNIDPSLYGQENLTPEKKQDLARDLVDIALIKGAVKRGLPILGICRGMQEMNIA 131
           YL+GA SNIDP+LYGQEN TP K QD  RDL DI L+K A+KRGLPI GICRGMQE+N+A
Sbjct: 74  YLTGAGSNIDPALYGQENQTPGKGQDQNRDLFDIPLVKAAIKRGLPIFGICRGMQEINVA 133

Query: 132 FGGDLYQKVHDEDHLNDHREDPDTPPDVQYGASHSISMVKGSWLHKLLG-DTIEVNSLHG 190
            GGD+YQKV+ E   NDHRE+P+ P +VQY   H + +  GSWLH  LG D I VNSLHG
Sbjct: 134 LGGDIYQKVYAEPGFNDHRENPEDPVEVQYAQVHGVKIQPGSWLHDTLGTDEIRVNSLHG 193

Query: 191 QGIKTLGKGLEALALAEDGLVEALHAPYLPQFTLGVQWHPEWKALENPDSIKIFKAFGEA 250
           QG+  LG G+EA+A AEDGLVEA+HAP +  F   VQWHPEW+A +NPDSIKIF+AFG+A
Sbjct: 194 QGLHKLGAGIEAIARAEDGLVEAIHAPSISPFLFAVQWHPEWQAAKNPDSIKIFQAFGDA 253

Query: 251 CRRRAGSA 258
           CR +   A
Sbjct: 254 CRAQVRKA 261


Lambda     K      H
   0.318    0.137    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 290
Number of extensions: 9
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 267
Length of database: 269
Length adjustment: 25
Effective length of query: 242
Effective length of database: 244
Effective search space:    59048
Effective search space used:    59048
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 47 (22.7 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory