Align Ornithine aminotransferase; OAT; EC 2.6.1.13; Ornithine--oxo-acid aminotransferase (uncharacterized)
to candidate PP_0372 PP_0372 Acetylornithine aminotransferase 2
Query= curated2:Q89RB7 (404 letters) >FitnessBrowser__Putida:PP_0372 Length = 426 Score = 217 bits (552), Expect = 6e-61 Identities = 136/372 (36%), Positives = 189/372 (50%), Gaps = 9/372 (2%) Query: 26 VLSRGEGVWVWDTDGNRYLDCLSAYSAVSQGHCHPKILAAMVEQAHRLTLTSRAFHNDQL 85 V RG+G W+WD +G+ YLD + S GH ++ A+ QA L FHN L Sbjct: 45 VFVRGQGSWLWDNEGHAYLDFTQGGAVNSLGHSPSVLVKALGNQAQALINPGSGFHNRGL 104 Query: 86 APFYEEIAALTGSHKVLPMNSGAEAVESAIKSVRKWGYEVKGVPDDQAEIIVCADNFHGR 145 + TGS + +NSGAEA E AIK RKWG + + II + HGR Sbjct: 105 LGLVNRLCQSTGSDQAYLLNSGAEACEGAIKLARKWGQLHR---NGAYHIITASQACHGR 161 Query: 146 TLGIVGFSTDPETRGHFGPFAPGFRIIPFGDAAALEQAITPNTVAFLVEPIQGEAGVIIP 205 +LG + S DP P PGF +PF D AAL + TVA ++EPIQGEAGVI Sbjct: 162 SLGALSAS-DPLPCNRCEPGLPGFSKVPFNDLAALHAEVDSRTVAIMLEPIQGEAGVIPA 220 Query: 206 PAGYFTKVRELCTANNVMLVLDEIQTGLGRTGKLLAEQHEGIEADVTLLGKALAGGFYPV 265 Y V LC ++L+LDE+QTG+GR G LLAE+ G+ AD+ LGK L GG P+ Sbjct: 221 TQEYLKGVETLCRELGILLILDEVQTGIGRCGALLAEELYGVRADIITLGKGLGGG-VPL 279 Query: 266 SAVLSNNEVLGTLRPGQHGSTFGGNPLACAVARAAMRVLVEEGMIENAARQGARLLEGLK 325 +A+L+ + PG+ + GN L CA A + ++E G + G L EGL Sbjct: 280 AALLARGKAC-CAEPGELEGSHHGNALMCAAGLAVLDSVLEPGFLAQVQDNGRHLREGLS 338 Query: 326 DIRANTVR-EVRGRGLMLAVELHPEAGRARRYCEALQGKGILAKDTHGHTIRIAPPLVIT 384 + + EVRG GL+ A++L + AR A +G+L +R +P L ++ Sbjct: 339 RLTGRYGQGEVRGHGLLWALQL--KENLARELVAAALHEGLLLNAPQVDVVRFSPALTVS 396 Query: 385 SDEVDWALEQFA 396 +D L + A Sbjct: 397 KGNIDEMLLRLA 408 Lambda K H 0.319 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 511 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 404 Length of database: 426 Length adjustment: 31 Effective length of query: 373 Effective length of database: 395 Effective search space: 147335 Effective search space used: 147335 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory