Align deoxynucleoside transporter, permease component 1 (characterized)
to candidate PP_2760 PP_2760 putative ribose transport permease protein
Query= reanno::Burk376:H281DRAFT_01115 (357 letters) >FitnessBrowser__Putida:PP_2760 Length = 327 Score = 105 bits (262), Expect = 2e-27 Identities = 94/302 (31%), Positives = 140/302 (46%), Gaps = 15/302 (4%) Query: 27 VLVATWLSRGQFVDIDNLQSMGGQLPELGLLALGIMLSMVSG-----NGGIDLSGVGLAN 81 +L+A LS F+ + NL ++ Q LG LA G+ ++ G +GG+DLS Sbjct: 30 ILLAFALSAPNFLTLSNLVNVLAQSAILGSLAFGLTTVIIGGGSNVVSGGLDLSLAANLG 89 Query: 82 LSGMVAAMLVPRLVNGDDSPVLYTSLFCAIVLMMGLLGGLLNGVVIARLRLTPILCTLGT 141 LS V A L ++ + A L GL G LN +V+ RL P+L TL T Sbjct: 90 LSAAVYASL--------NNAGFGDVVSIAATLGTGLAIGTLNALVVVGFRLPPLLATLAT 141 Query: 142 QLLFTGFAVVISNGASVHVDYVEPLSDIGNGTVLQVPIAFCIFLAAVIVLGWLLKRSPFG 201 L G +V++ +V L + G+ + VP + LA VL L + +PFG Sbjct: 142 MNLVAGLELVLTEN-TVLPSTSPLLEGLAFGSWVGVPALAWVLLAVGGVLIVLTQYTPFG 200 Query: 202 LRLYLMGTNPKAAFYAGIPRARMLITTYAMCGVLASLAGLISATHTSSAKWDYGNSYLLI 261 LRLY +G P+AA AG+ + +Y + G+ SLA SA S + G LL Sbjct: 201 LRLYAIGEYPEAANAAGLSVRGYVFASYLISGLCGSLAAFCSAAWFSGSTTGSG-EMLLS 259 Query: 262 AILIAVMGGVNPAGGHGRIICVFFAATVLQFLSSLFNLLGVSQFFGDCAWGFLLLLSLAF 321 + IA +G + I A ++ L + F LL +S F+ D G L+LL +A Sbjct: 260 VVAIAFLGVIFSQRLQPSIGGTLLATLLVGVLINGFQLLNISSFWVDGVQGVLILLVVAL 319 Query: 322 AG 323 +G Sbjct: 320 SG 321 Lambda K H 0.327 0.143 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 321 Number of extensions: 22 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 357 Length of database: 327 Length adjustment: 29 Effective length of query: 328 Effective length of database: 298 Effective search space: 97744 Effective search space used: 97744 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory