Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate PP_1951 PP_1951 Oxidoreductase, short chain dehydrogenase/reductase family
Query= reanno::Burk376:H281DRAFT_00644 (263 letters) >FitnessBrowser__Putida:PP_1951 Length = 275 Score = 114 bits (286), Expect = 2e-30 Identities = 84/270 (31%), Positives = 128/270 (47%), Gaps = 33/270 (12%) Query: 12 GLRVFVSAGAAGIGLAIAEAFIEAQAEVYICDVNQAAIDEATSRFPKL----HAGIADVS 67 G RV V+ A+G+GLA EA E+ A+V + D+N+ A+D R L + + DV+ Sbjct: 11 GARVIVTGAASGLGLAFTEAMAESGAQVAMLDLNREALDAQFRRLRSLGYSVRSHVLDVT 70 Query: 68 KQAQVDQIIDDARRKLGGLDVLVNNAGI-----------AG---PTGAVEELDPAQWEST 113 + VD + GGLD++ NAGI AG P +EE +W Sbjct: 71 DRDAVDDTFNAVAAGFGGLDIVFANAGIDPGPGFAALNAAGEREPANMLEEYSDHRWRKV 130 Query: 114 VSTNLNSQFYFLRKAVPVLKETSDCASIIAMSSVAGRLGYPFRTPYASTKWAIVGLVKSL 173 +S +L++ FY +R A ++ + I+ S A R YA+ K LV++ Sbjct: 131 ISVSLDAVFYSIRAAARHMRANRSGSIIVTTSVSALRPAVTLGAAYAAAKAGAAQLVRAT 190 Query: 174 AAELGPSNVRVNAILPGVVEGERMDRVISARADALGIPF---NAMREEYLKKISLRRMVT 230 A EL VRVNAI PG E + +G F + +R + + + R+ Sbjct: 191 ALELASDGVRVNAIAPGPFETD------------IGGGFMHNSEVRAKMAAGVPMGRIAE 238 Query: 231 VDDIAAMALFLASPAGSNVTGQAISVDGNV 260 V++I +AL+LAS A S VTGQ +DG + Sbjct: 239 VEEIKPLALYLASKASSFVTGQQFVIDGGL 268 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 275 Length adjustment: 25 Effective length of query: 238 Effective length of database: 250 Effective search space: 59500 Effective search space used: 59500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory