Align 2-deoxy-3-keto-D-ribonate cleavage enzyme (characterized)
to candidate PP_0303 PP_0303 dehydrocarnitine cleavage enzyme
Query= reanno::Burk376:H281DRAFT_00641 (312 letters) >FitnessBrowser__Putida:PP_0303 Length = 294 Score = 160 bits (405), Expect = 3e-44 Identities = 105/317 (33%), Positives = 162/317 (51%), Gaps = 48/317 (15%) Query: 8 VIISCAITGATHVPSMSEFLPITPEQIRDQAIEAAQAGAAIIHLHARDPVDGRPTPSPEI 67 VII+CA+TGA S S +P+TP+QI + A+EAA+AGA ++H H RDP GR + + Sbjct: 5 VIITCALTGAGDTASKSHLVPVTPKQIAESAVEAAKAGATVVHCHVRDPQTGRFSRDVAL 64 Query: 68 FKAFVPAIAEA-TDAVINITTG---------GSTRMTLE---------ERLAYPRLARPE 108 ++ + I EA D ++N+T G G T + ERLA+ PE Sbjct: 65 YREVMERIREADVDIIVNLTAGMGGDLEIGPGETPLAFGPGTDLIGPLERLAHVEALLPE 124 Query: 109 MCSLNMGSMNFSIHPVAAKISSWRYGWEKDYIEGMEDMIFRNTFRDIRNILLELGESGTR 168 +C+L+ G++NF G + I+ +T +R + E G + Sbjct: 125 ICTLDCGTLNF----------------------GDGNSIYVSTPAQLRAGAKRITELGVK 162 Query: 169 FEFECYDVGHLYNLAHFVDQGLVKPPFFIQSVFGILGGLGADPENMLLMRSTADRLFGRE 228 E E +D GHL+ + +GL++ P F Q GI G AD M++ D L Sbjct: 163 AELEIFDTGHLWFAKQMMKEGLLEDPLF-QLCLGIPWGAPADTTT---MKAMVDNL--PA 216 Query: 229 NYHFSVLGAGRHQMPLVTMSAIMGGNVRVGLEDSVYLAKGVKAETNAQQVRKIRRILEEL 288 N ++ G GR QMP+ + ++GGNVRVGLED++YL +GV A +N Q V + I+ + Sbjct: 217 NVTWAGFGIGRMQMPMAAQAVLLGGNVRVGLEDNLYLDRGVLA-SNGQLVERASEIITRM 275 Query: 289 SLEIATPADARKMLGLK 305 + +PA+ R+ + LK Sbjct: 276 GGRVLSPAEGREKMNLK 292 Lambda K H 0.321 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 312 Length of database: 294 Length adjustment: 27 Effective length of query: 285 Effective length of database: 267 Effective search space: 76095 Effective search space used: 76095 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory